KEGG   Fragaria vesca (woodland strawberry): 101294444Help
Entry
101294444         CDS       T02666                                 

Definition
(RefSeq) alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00500  Starch and sucrose metabolism
fve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101294444
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101294444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 101294444
NCBI-ProteinID: XP_011461488
LinkDB All DBs
Position
LG3
AA seq 403 aa AA seqDB search
MVVGWXSQGFNWESAKKGGWYNILEQSAAELASSGITHVWLPPPSQAISDEGYMPGRLYD
LTSKYGNQDGLKALVKAYQDNGIKSVADIVINHRCAEKQDERGIWCIFEGGTPDDRLDWG
PSLICSDDTKYSDGKGNPDTGADFGGAPDIDHKNTRVQSELSDWMNWLKTEIGFSGWRFD
FVRGYAPEFTKLYVANTKPSFSVGEYWNSIAYGSDGKPEYNQDNHRNELAGWIGNAGGEV
TAFDFTTKGILQAAVQGELWRLKDSNGGPPGLIGISPRNSVTFIDNHDTGSTQKLWPFPS
DKVMQGYAYTLTHPGIPSIFYDHFFDWGLKGEISKLTAIRSRNGIKPDSAVRILAADADL
YVASIDDKIITKIGPRFDVGNLVPPTFKIATSGKDYSVWEKSA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggttgttggttggtgatctcaggggttcaattgggaatcagcaaagaagggaggatgg
tacaacatcttggagcagtccgcagctgaactagcttcttcaggaattacacatgtttgg
cttccaccaccttctcaggctatttcagatgaaggctacatgcctggcaggctctatgat
ctcacatcaaaatatggaaaccaagatggattaaaggcactggtaaaagcctaccaagac
aatgggataaagagcgtagcagatattgttataaaccatagatgtgcagagaagcaagat
gaaagaggaatatggtgcatttttgagggaggaacaccagatgatcgccttgattggggg
ccgtctcttatttgcagtgacgacacaaaatattctgatggcaagggaaaccctgatact
ggagctgactttggtggtgctcctgacattgatcacaaaaacacaagggtccagagtgag
ctctcggattggatgaactggttaaagaccgaaattggtttcagcggctggcgatttgat
tttgtcaggggatatgctccagagttcaccaagctgtatgtggccaacacaaagcctagt
ttctcagtaggagagtattggaattccattgcttatggaagtgatggaaaacctgagtac
aaccaggacaaccatcgcaacgagctcgctggatggatagggaatgctggaggagaggtt
actgcttttgattttacaacaaaagggatacttcaagctgctgtccagggtgaactgtgg
aggttgaaggactcgaatggaggtcctcctggattgattggaatatcgccacgcaatagt
gtgacattcatagacaatcatgatacaggttccacacaaaaattgtggccatttccatca
gataaagtcatgcagggatatgcttacactcttactcatccaggcatcccatcaatattc
tatgaccacttctttgactggggattgaaaggggagatctcgaaactcactgcaattagg
tccaggaatgggatcaaacccgacagtgccgtccgtatcctagcagctgatgcagatctc
tatgtagcttccatagatgacaaaatcataaccaagattggtccaagattcgacgttggg
aaccttgtaccgccaacattcaaaatcgcaacttctggaaaggattatagtgtttgggag
aaatcagcatga

DBGET integrated database retrieval system