KEGG   Fragaria vesca (woodland strawberry): 101294758Help
Entry
101294758         CDS       T02666                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00250  Alanine, aspartate and glutamate metabolism
fve00410  beta-Alanine metabolism
fve00430  Taurine and hypotaurine metabolism
fve00650  Butanoate metabolism
fve01100  Metabolic pathways
fve01110  Biosynthesis of secondary metabolites
Module
fve_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101294758
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101294758
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101294758
   00430 Taurine and hypotaurine metabolism
    101294758
Enzymes [BR:fve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101294758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 EspB
Motif
Other DBs
NCBI-GeneID: 101294758
NCBI-ProteinID: XP_004299488
LinkDB All DBs
Position
LG5
AA seq 504 aa AA seqDB search
MVISSTSGDRSDHFLDCTFASRYVRNPVPKFRMPESSQPKEAAYQIINDELMLDGTPRLN
LASFVTTWMEPECEKIMMASMNKNYVDMDEYPVTTELQNRCVNMISHLFNAPIGEAETAI
GVGTVGSSEAIMLAGLAFKRKWQHRRKLEGKPFDKPNIVTGANVQVCWEKFARYFEVELK
EVKLSDGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLIKKNKETGWET
PIHVDAASGGFIAPFLYPDIEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRSKEDLPDE
LVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNVMENCMENARALKEGLL
STGRFKILSKDIGVPLVAFTLKDSSKHTVFEIADTLRKYGWIVPAYTMPANAEHVAVLRV
VVREDFSRSLAERLLSDIDKVLKEIDTLPSRVSMKAAHVSATVDEVVNASEGMVNAAKKS
IEEIQKEVATYWKNLVERKRTGAC
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtgatctcttcgacctccggtgaccgttcagatcactttctggactgcacctttgct
tccagatatgtgcgcaatcccgtccccaagttcaggatgccggagagttcacaacccaaa
gaggcagcttatcagataataaacgacgagcttatgctggatgggactccgaggctcaac
ttggcctcatttgtgaccacctggatggagccggaatgcgaaaaaatcatgatggcctcc
atgaacaagaactatgtcgacatggatgagtaccctgtcaccactgaacttcagaatcgc
tgtgtgaatatgatttcccaccttttcaatgctcccatcggagaagctgaaactgctatt
ggtgtgggaacggtaggatcttcagaggcaataatgctagcaggcctggcttttaaaaga
aaatggcagcacaggagaaaattagaaggcaaaccctttgacaaacccaacattgtgact
ggagctaacgtgcaggtttgctgggaaaagtttgctaggtatttcgaggtcgaactgaag
gaggtgaagctatcagatggatactatgtgatggaccctgtcaaagcagttgagatggtt
gatgagaacactatctgtgttgcagctattctaggttcaaccctgacgggagagtttgag
gatgtgaaactccttaatgaccttcttattaagaagaataaggagacaggatgggaaact
cccattcatgttgatgctgccagtggaggctttatagctccattcctttatcctgatatt
gagtgggacttccgtttgccattagtcaagagtatcaatgtaagtggccacaagtatggc
cttgtatatgctggtgttggatgggttgtgtggaggagtaaagaggacttgcccgatgag
cttgtgtttcacatcaattatcttggatctgaccaaccaactttcaccctcaacttttcc
aaagggtctagccagataattgctcagtactatcagtttatacgtctgggatttgagggt
tacaaaaatgtgatggaaaactgcatggagaatgcaagagcactgaaagaaggactattg
agtacaggtcgatttaaaattctttcaaaagacataggagtgccccttgtggctttcact
ctaaaagacagcagcaagcacactgtgtttgagatagctgatactttgagaaagtatgga
tggatagttccagcctacactatgccagccaatgcagaacatgttgctgttcttcgcgtg
gttgtcagggaggactttagtcggagcttggcagagagactcctctcagacatcgacaag
gttttgaaagaaatcgacacactgccaagccgcgtgtctatgaaagctgcacatgtctcg
gctactgtcgacgaagtagtcaatgccagtgaagggatggtaaatgctgctaagaaaagt
atagaggagattcagaaagaggtagcaacatattggaagaaccttgtggaaagaaagaga
acaggtgcatgctag

DBGET integrated database retrieval system