KEGG   Fragaria vesca (woodland strawberry): 101297585Help
Entry
101297585         CDS       T02666                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00250  Alanine, aspartate and glutamate metabolism
fve00410  beta-Alanine metabolism
fve00430  Taurine and hypotaurine metabolism
fve00650  Butanoate metabolism
fve01100  Metabolic pathways
fve01110  Biosynthesis of secondary metabolites
Module
fve_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101297585
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101297585
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101297585
   00430 Taurine and hypotaurine metabolism
    101297585
Enzymes [BR:fve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101297585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 TSLP
Motif
Other DBs
NCBI-GeneID: 101297585
NCBI-ProteinID: XP_011469669
LinkDB All DBs
Position
LG1
AA seq 501 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRTSLPRFRMGENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRRAEGLPVDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDDYFVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNNETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLLLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNIMENCRENMIVLREGLEK
TGRFKIVSKDEGVPLVAFSLKDNHCHDEFEISDLLRRYGWIVPAYTMPADAQHVTVLRVV
IREDFSHTLAERLVNDIQKVLHELDRLPSKLSSNSTIETQEIENNEKSTVTTKKSALETQ
REITTIWRKFVMDKKKITGVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctccaaaaccgcatcggagtcagatgtctctgtccactccacctttgcttcg
cgatacgttcgaacttctcttccgaggttcagaatgggagagaactcgatcccgaaggag
gcggcgtatcagatcataaacgacgagctgatgctggacggaaatccaaggctgaatctg
gcgtcgttcgtcacgacgtggatggagccggaatgcgataagctcatcatgtcctccatc
aacaagaactacgtcgacatggacgagtaccctgtcaccactgagctccagaaccggtgc
gtgaacatgatagctcatctattcaatgcaccactcggagaatcagaggcggccgttgga
gtcggcacggtgggatcttcggaggccatcatgttggccggattggccttcaagagaaag
tggcagaacaagaggagagctgaaggattaccggtcgacaagcccaacattgtcaccgga
gccaatgttcaggtgtgctgggagaaatttgctagatactttgaggtggagctgaaggag
gtgaagctgagggatgattacttcgtaatggaccctgagaaagcagtggagatggtcgat
gagaacaccatctgcgtcgcggctatcctcggttccactttaaatggcgagtttgaggac
gtcaagcgcttgaatgatctcctcgtagagaaaaacaacgaaactggatgggatactcca
atccatgtagacgccgcgagtggtggattcattgctccatttttgtacccggaactcgag
tgggatttccgtttgctgctggtgaagagcatcaacgtgagcgggcacaagtacgggctt
gtgtatgccggaattgggtgggtcatttggaggaacaaagaggacttgcctgaggagctc
atctttcatatcaactaccttggagcagatcaacctaccttcaccctcaacttctctaaa
ggatccagccaagttattgctcagtattaccaactgattcgcttgggttttgagggatac
aggaacatcatggaaaattgtcgtgaaaatatgattgtacttagagaaggactcgagaag
acgggccgcttcaagatcgtctccaaggatgaaggagtacccttggtggctttttctctc
aaagataaccactgccacgatgagtttgagatctccgatttgttgcgtcgctacgggtgg
atcgtgccagcatacactatgccggcagatgctcagcatgtcacggtgctgcgtgtggtc
atcagagaagacttttctcacactcttgctgagcgcctcgtcaatgatatccagaaagtt
ctgcatgagctcgatcgccttccatcaaagctcagctccaacagtactattgaaacccaa
gagattgagaacaatgagaagtccaccgtcaccacaaagaagagtgctttggagacacag
agggaaatcaccaccatttggaggaagtttgttatggacaagaagaagataaccggtgtg
tgttag

DBGET integrated database retrieval system