KEGG   Fragaria vesca (woodland strawberry): 101298221Help
Entry
101298221         CDS       T02666                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00010  Glycolysis / Gluconeogenesis
fve00053  Ascorbate and aldarate metabolism
fve00071  Fatty acid degradation
fve00280  Valine, leucine and isoleucine degradation
fve00310  Lysine degradation
fve00330  Arginine and proline metabolism
fve00340  Histidine metabolism
fve00380  Tryptophan metabolism
fve00410  beta-Alanine metabolism
fve00561  Glycerolipid metabolism
fve00620  Pyruvate metabolism
fve00903  Limonene and pinene degradation
fve01100  Metabolic pathways
fve01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101298221
   00053 Ascorbate and aldarate metabolism
    101298221
   00620 Pyruvate metabolism
    101298221
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101298221
   00561 Glycerolipid metabolism
    101298221
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101298221
   00310 Lysine degradation
    101298221
   00330 Arginine and proline metabolism
    101298221
   00340 Histidine metabolism
    101298221
   00380 Tryptophan metabolism
    101298221
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101298221
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    101298221
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101298221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101298221
NCBI-ProteinID: XP_004298932
LinkDB All DBs
Position
LG5
AA seq 532 aa AA seqDB search
MAVRRLSSLLSRALSSASSSKLLSQGRSVSRFSSTAAASEELITPPVHIEHTKLLINGQF
VDSASGKTFPTYDPRTGEVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMSAYERSRILL
RFADLVEKHSEELAALETWNNGKPFVQASQAELPMVVRLLHYYAGWADKIHGLTVPADGP
YHVQTLHEPIGVAGQIIPWNFPLLMFVWKVGPALACGNTIVLKSAEQTPLTALYVAKLFQ
EAGLPPGVLNVVSGYGPTAGAALASHMDVDKVAFTGSTDTGKIILELAAKSNLKSVTLEL
GGKSPFIICKDADIDHAVELAHFALFFNQGQCCCAGSRTFVHEHVYDEFLEKAKARALKR
TVGDPFKKGIEQGPQIDSEQFQKVLKYIKSGVESDATLECGGERFGSKGYFIQPTVFSNV
QDDMLIAQDEIFGPVQSILKFKEIDEVVRRANSTRFGLAAGVFTKNIDTANTLTRALRAG
TVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcggagactctcctccttactctctcgcgctctctcttctgcttcttcttct
aagcttctttctcaagggagaagtgtcagcaggtttagcagtactgctgcagcaagtgaa
gagttgatcaccccacctgttcatattgaacacactaagcttctaatcaatggccagttt
gttgattctgcatcaggaaaaacatttccaacctacgatcctcgcacaggagaagtaatt
gctcatgtggcggagggtgatgcagaagatattaatcgtgcagtagctgctgctagaaag
gcttttgatgagggaccatggcccaagatgtccgcttatgaaaggtcacggatactatta
cgatttgctgatttggttgagaaacacagtgaagagcttgcagctcttgagacatggaac
aatggcaaaccttttgtgcaggcttcccaagccgaattgccaatggtggtccgtttgttg
cactactatgctggatgggcagacaaaatccatgggctaactgttccagctgatggacct
tatcatgtgcaaacgctgcacgaaccaatcggtgttgcaggacagattattccatggaac
tttcctcttctcatgtttgtctggaaagttgggcctgcactggcatgtggtaatactatt
gtcctaaaaagtgcagagcagacgcctctcactgccctctatgtggcaaagctattccaa
gaggccggtcttcctcctggtgttttaaatgtagtttccggttatggcccaactgctggt
gctgctcttgccagtcatatggatgtggacaaggtagcttttactggatcaactgacact
ggtaagattattcttgaactggctgcaaaaagcaatcttaagtcagtaacattagagctc
ggagggaagtcacctttcataatatgcaaggatgctgacattgatcatgctgtagagctt
gcacactttgctctcttctttaatcaggggcaatgctgctgtgctgggtctcgtacattt
gtacatgagcatgtatatgatgagtttttggaaaaagcaaaggctcgtgctttgaaacgt
actgttggtgatcccttcaagaagggtatcgaacaaggtccccagattgactcagagcag
tttcagaaggttcttaaatacataaaatctggtgttgaaagtgatgctacacttgaatgt
ggaggtgaaagatttggctccaaaggctacttcatccagcctactgtattctcaaatgtc
caggatgacatgttgattgcacaagatgagatctttggccccgtgcaatcaattttgaaa
ttcaaggaaattgatgaagtagtacgaagagctaattcaacgcgctttggacttgctgct
ggggttttcaccaaaaacattgacactgccaacaccttgacacgggcgttgagggctggg
acagtgtgggtgaattgcttcgatgtgtttgatgctgcgattccttttggtggctacaag
atgagtggaataggtagagaaaagggaatctacagtcttcataactacttgcaggtcaag
gctgttgttactcctttgaagaatccagcatggttgtaa

DBGET integrated database retrieval system