KEGG   Fragaria vesca (woodland strawberry): 101303102Help
Entry
101303102         CDS       T02666                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00061  Fatty acid biosynthesis
fve00780  Biotin metabolism
fve01100  Metabolic pathways
fve01212  Fatty acid metabolism
Module
fve_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101303102
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    101303102
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    101303102
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fve01004]
    101303102
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     101303102
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     101303102
Lipid biosynthesis proteins [BR:fve01004]
 Fatty acid synthase
  Component type
   101303102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 101303102
NCBI-ProteinID: XP_004295142
LinkDB All DBs
Position
LG3
AA seq 391 aa AA seqDB search
MATTAASSLQMATARPCISSSRRVFRSGAAMLHGNVKVVSSSKLSSVCHISSVQTFQQSF
TSSSLKMSKFVTKAMSGSSENKSSGLPINLKGKRAFIAGVADDNGYGWAIAKSLAAAGAE
ILVGTWVPALNIFESSLRRGKFDESRVLPDGSLMEITKVYPLDAVFDNPDDVPEEVKANK
RYAGSSNWTVQEAAEAVKNDFGSIDILVHSLANGPEVTKPLLETSRKGYLAAISASSYSY
VSLLKHFLPIINPGGSSLSLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKKKI
RVNTISAGPLRSRAAKAIGFIDMMIDYSLVNAPLQKELSAEEIGNTAAFLASPLASAITG
SVIYVDNGLNTMGVGVDSPIFEKLDIPKDQH
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaactactgctgcttcgagcctgcaaatggcaacagcaagaccctgcatttcctct
tctcgtagagttttcaggtctggtgccgcaatgcttcatggcaatgtcaaagtggtttcg
tcgtctaagctctcgagtgtgtgccatatatcatctgtgcaaaccttccaacagagcttt
acatcatcatctttgaaaatgagtaagtttgttacaaaggcaatgtctggatctagtgag
aacaagtcctccgggttgccaattaatctgaaaggtaaaagagcattcattgctggtgta
gccgacgataatggatatgggtgggcaattgcaaaatctctagctgctgcaggtgctgaa
attctcgtgggaacttgggtccctgctctgaacattttcgagtccagtctgcgacgtggg
aagtttgatgaatcacgcgtgttaccagatggttctttgatggagattactaaagtatat
cccctagatgcagtttttgataaccctgacgatgttcctgaggaggtgaaagcaaataag
cgctatgctggatccagtaactggactgtccaggaagctgctgaagccgtgaagaatgat
tttggaagtattgacattcttgttcactcccttgctaatggaccagaggtcactaaacct
ctgttggagacatcccggaagggatatcttgctgctatatctgcatcaagttattcttat
gtttctttactgaagcatttcctcccaataattaatccaggtggttcttcactttctctt
acatatattgcttctgagaggataattcccggatatggtggaggtatgagctctgcaaaa
gctgcacttgagagtgacactcgggtgcttgcttttgaagctggtagaaaaaagaaaatt
cgagtcaacaccatatccgcaggtccactaagaagccgtgctgccaaagcaattggattc
attgatatgatgatcgactattcgctagtcaatgcacctctgcaaaaagaactatctgca
gaggagatagggaacacagccgctttcttggcatcacctttggcttctgccatcactggt
tcagttatatacgttgacaatggcttgaacacaatgggtgtcggagttgacagcccaata
tttgagaaacttgacattccaaaggatcagcactga

DBGET integrated database retrieval system