KEGG   Fragaria vesca (woodland strawberry): 101303935Help
Entry
101303935         CDS       T02666                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00020  Citrate cycle (TCA cycle)
fve00190  Oxidative phosphorylation
fve01100  Metabolic pathways
fve01110  Biosynthesis of secondary metabolites
fve01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101303935
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101303935
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101303935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 101303935
NCBI-ProteinID: XP_004287904
LinkDB All DBs
Position
LG1
AA seq 634 aa AA seqDB search
MWRCVSRRLGVSSPSRSVAANDSLRSHFSRLFSSDSATGRSSYTVVDHTYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACA
ADRTGHALLHTLYGQAMRHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQASS
TILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPMKDHIYLHLNHL
PPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDA
VIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGE
KTIAWLDKLRNSNGSLPTSKIRLNMQRIMQNNAAVFRTHETLVEGAELIDKAWESFNDVQ
VKDRTLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTTRDDEKWMKHSL
GYWENEKVRLDYRPVHMNTLDDEIDTFPPKARVY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtttctcggcggctcggcgtttcttcgccctcgagatcagtcgcggcc
aatgactctcttagatctcacttctccagactcttctcctctgattcggctactggacgc
tcgtcttatactgtggtggatcacacttacgacgccgtggtggtcggggctggcggtgca
gggctgagagcagccatagggctttcggagcatggatttaataccgcatgcattactaag
cttttccctactcgttcacacaccgttgcagctcagggtggtataaatgctgcattaggg
aatatgactgaggatgactggaggtggcacatgtacgacacggtgaagggaagtgattgg
ctgggtgatcaagatgccatccagtatatgtgtagagaggctccaaaagctgtgattgaa
cttgaaaattatggtctgcccttttctcgaactgaagatggaaaaatatatcagcgtgca
tttggtggtcaaagtcttgactttggaaaaggtggacaagcgtaccgttgtgcttgtgct
gccgacagaactgggcatgctcttttgcatactctctacggacaagctatgaggcataat
acacagttttttgtcgaatattttgctctggatcttttaatgaacagtgatgggagctgc
caaggagttattgcattaaatatggaggatgggactttgcatcggttccaagcttcatcg
acaatattggccacagggggttatggtagagcatacttttctgcaacctcagcacatacc
tgcactggagatggcaatgccatggtggcacgtgctgggctcccacttcaggatttggag
tttgtgcagtttcaccctactggtatatatggcgctggatgccttattactgaaggatca
cgaggggaaggtggtatcctaagaaacagtgaaggtgagcgatttatggaacgatatgcc
ccaacagcaaaagatcttgcttctagagatgttgtgtcaagatccatgactatggaaatc
cgggagggtcgtggtgtaggacctatgaaggaccatatctatctccacttgaatcatttg
cccccagatgtactaaaggagaggcttcctggtatttctgaaactgctgccatttttgct
ggagtcgatgtcactaaagagcctattcctgtgttacccactgtacactacaatatgggt
ggaattccaaccaattaccatggagaggtagttaccattaaaggtgataatccagatgca
gtaattcctgggttaatggcagctggggaggcagcctgtgcatcggttcatggtgctaat
cggcttggtgcaaattcactccttgacattgttgtttttggccgagcatgcgcaaataga
gttgcagagattagtaaacctggggagaaacaaaagcctctggaaaaggatgctggcgag
aagaccattgcttggttggacaaattgagaaattcaaatggctcactgccgacttcaaaa
attcggttgaatatgcaacgaataatgcaaaataatgctgctgtgttccgtacacacgag
acattagtagaaggtgctgagttgattgacaaggcatgggagagttttaatgatgttcaa
gtaaaggatcgaactttgatatggaactctgacttgattgagactattgagttagaaaac
cttttgataaatgcatgtatcaccatgcattctgctgaagccaggaaagagagccgagga
gcacatgctcgtgaagatttcacgacaagagatgacgaaaaatggatgaaacattctttg
ggatactgggaaaatgagaaggttcgactagactacagaccggttcacatgaacacatta
gacgatgaaatcgataccttccctcctaaggctcgtgtctactga

DBGET integrated database retrieval system