KEGG   Fragaria vesca (woodland strawberry): 101303987Help
Entry
101303987         CDS       T02666                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00630  Glyoxylate and dicarboxylate metabolism
fve00710  Carbon fixation in photosynthetic organisms
fve01100  Metabolic pathways
fve01200  Carbon metabolism
Module
fve_M00165  Reductive pentose phosphate cycle (Calvin cycle)
fve_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
fve_M00532  Photorespiration
fve_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101303987
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101303987
Enzymes [BR:fve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101303987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 101303987
NCBI-ProteinID: XP_004296442
LinkDB All DBs
Position
LG4
AA seq 190 aa AA seqDB search
MFLYKSHCAVFFVKQKMSASIFKSPVPASGYVGLATSPSKIFPAKDSIGWTKKTVSNCSR
TCCMKSWNPINNKKFETLSYLPPLSDDSIAKEIDYMLKKGWIPCLEFDEVGYVQRENSRM
PGYYDGRYWTLWKLPMFGCIDPSLVLNEIQECKKTYPNAYIRCVAFDNQNQGQCMAFIIQ
KPNIAATTSA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttacaaatcacactgtgctgtgttctttgttaaacagaagatgtctgcttct
atcttcaaatctcctgttcctgcatctggttacgttggcttagcaaccagcccttccaaa
attttcccagctaaagactctatcggatggaccaagaaaactgtctccaattgttcaaga
acttgctgcatgaagtcatggaatccgatcaacaacaagaagtttgaaactttgtcttac
ctcccaccactctctgatgattcaattgcaaaggagattgactacatgctcaagaagggg
tggatcccttgccttgaatttgacgaggtgggatatgttcaaagggagaatagcaggatg
ccagggtactatgatggaagatattggacgttgtggaagctacccatgtttggttgcatt
gacccttctctggtgctcaatgaaatccaagagtgcaagaaaacgtacccaaatgcttat
atacgttgtgtagcatttgacaaccagaaccagggtcagtgcatggcctttatcattcag
aagccaaacattgcagccaccaccagtgcttga

DBGET integrated database retrieval system