KEGG   Fragaria vesca (woodland strawberry): 101304313Help
Entry
101304313         CDS       T02666                                 

Definition
(RefSeq) uncharacterized LOC101304313
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve03030  DNA replication
fve03410  Base excision repair
fve03420  Nucleotide excision repair
fve03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:fve00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101304313
   03410 Base excision repair
    101304313
   03420 Nucleotide excision repair
    101304313
   03430 Mismatch repair
    101304313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fve03032]
    101304313
   03400 DNA repair and recombination proteins [BR:fve03400]
    101304313
Enzymes [BR:fve01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101304313
    6.5.1.6  DNA ligase (ATP or NAD+)
     101304313
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101304313
DNA replication proteins [BR:fve03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101304313
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101304313
DNA repair and recombination proteins [BR:fve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101304313
   NER (nucleotide excision repair)
    Other NER factors
     101304313
   MMR (mismatch excision repair)
    Other MMR factors
     101304313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 101304313
NCBI-ProteinID: XP_004305525
LinkDB All DBs
Position
LG6
AA seq 1389 aa AA seqDB search
MAVLDSTDLYLTALTTFSHPHPPPPQLSLPTLPPTFPHSKLIPRTRFAVDAFRYAGDYSV
SYFLSHFHSDHYGGLSPSWSKGLVFCSPTTARLLTQVLRVSSLFVVALPLRQPLVIDGCE
VVLVDANHCPGAVQFLFQVPLPGGAQLSERYLHTGDFRFSPCMKSDPFLSTFVGCEAVFL
DTTYCNPKFVFPSQQESVDYVCRVIQTETVVGQPKTVLFLVATYVIGKEKILLEIARRCN
RKVHVDARKMAVLRVLGFGDSGVFTEDECETDVHVVGWNVLGDTWPYFRPNFVKIEEIMA
HKGYSRVVGFVPTGWTYEVKRNKFSVRSKDALEIHLVPYSEHSNYDELREYVRFLKPKRV
IPTVGSDVEKIDSKHAGKMQKHFAGLIDEMANKKEFLRGFHCGSTEVGGKVDSDANDCPM
DGQYLDEKASTDTNVGAPIQLFSPLQEPDSQTPMLLTDDKEEEIIQELRNCLPSWVTRQQ
MLELIGSSGGDIVEAVSKFYDRETEFRGQGIASATAVSVSETSKLCDTATPTKAGSVHAN
IDVSSSRDHISPNPSNIIIKSGISPGKRGKKISNKVNKKLKLQPKLESCGPKQSIITRFF
SKVLPDVTASGETGSMGEQNPKDKNLPDHGTQPYKDAVDQFLQIIDGNESLKSYADRVIR
KANGDISRAVDIHYCNEGKSGENEMELVAEANSVQSNSCVDNYSADQKIIELGKTGLLAD
SSVLLSSPDNIDATSVSLPPEKYNPVEHACWSNGQHAPYLHLARTFDLLENEKGKIKATS
MLCNMFRSLLALSPDDVLPSVYLCTNKIAADHKNVELNIGGSLVTSALEDACGTSRSKIR
DMYNELGDLGDVAQACRQTQTLLAPPSPLLIKDVFLALWKISVQTGSGSSARKRSLIVNL
MRSCREKEMKFLVRTLVRNLRIGAMMKTVLPALAQAVVLNSFHSCNHKGTIESLMDKLQR
HSAAVVEAYNVLPSLDVVIPSLMKRGIGFSSSTLSMVPGIPIKPMLARITNGVQQTLKLF
ENKAFTCEYKYDGQRAQIHKLVDGSVHIFSRNGDESTSRFPDLINIINQSCKPDALTFIL
DGEVVGVDRKNGCRLMSFQELSSRGRGSRDASITLDSIKVDICVFVFDIMFANGQQLLSF
PLRRRRKYLKEMFYDEKLGYFEYAKEMTVEAEDACLASEATLAKMNSFLENAFVSSCEGI
MVKCLDVDAGYLPSKRMDTWLKVKRDYIEGLRDSLDLVPIGAWHGNGRKAGWYSPFLMAC
YNPETEELQSVCRVMSGFSDLFYTEMKSFYSGDKILAKKPPYYRTAEVPDMWFSPELVWE
IRGADFTVSPVHQAALGLVHPSRGISIRFPRYIRTVTDRKPEECSTASDIAEMFHSQTRK
MDVASEDGS
NT seq 4170 nt NT seq  +upstreamnt  +downstreamnt
atggcggttctagattctacggacctctacctgacagccctaacaaccttttcacaccca
cacccgcccccacctcaactctctctccctacacttccccccacattcccccactccaaa
ctcattcccagaacccgtttcgccgtcgacgctttccgctacgccggcgattactccgtc
tcttacttcctctctcacttccactcggatcactacggcggtctctctcccagttggtct
aagggcctcgtgttctgctcccccaccaccgcccgtctcctcacacaggtcctccgcgtc
tcttctctctttgtcgttgccctcccactccgacaaccccttgtcatcgatggatgcgag
gttgtgcttgttgacgccaatcactgtccgggtgccgttcagttcttgttccaagtcccc
cttcccggcggtgcccaactctccgagaggtatcttcatactggtgattttcgattttct
ccttgcatgaagtcggacccttttctctctacatttgtgggctgcgaagccgttttcttg
gataccacttattgtaatcccaaattcgtgtttccttcgcaacaagaatctgttgattat
gtttgtcgcgtgatccagacggagacagttgtaggccaacccaaaactgttctcttcctt
gttgctacttatgttattgggaaagagaagattctgttggaaattgctcgtaggtgtaac
cgcaaagtgcatgtggatgctcggaaaatggccgtcttgcgcgtcttgggtttcggagac
agtggggtgtttacggaggatgaatgtgagactgatgtgcatgttgttgggtggaacgtc
ttgggtgacacttggccatatttccggcctaattttgtgaaaatagaggagattatggct
cataaggggtattccagggttgtaggctttgtccctactggctggacttatgaagtgaag
cgtaataagttttcggtaaggtcaaaggatgctcttgagatccatcttgtgccctacagt
gaacattcaaactatgatgaacttagagaatacgtgcggtttttgaaaccaaaacgcgtg
attcctactgtgggttccgatgtcgagaagattgacagtaaacatgccggtaaaatgcaa
aagcattttgctgggttgatcgatgaaatggctaacaaaaaagagttcttgaggggtttt
cattgtgggtctacagaagtaggtgggaaggttgacagtgatgccaatgattgccccatg
gatgggcagtatctggatgaaaaggcatcaactgatactaatgttggcgctcccattcaa
ttgttctctcctctccaagaacctgattcacaaactccaatgctgttaactgatgacaaa
gaggaggaaatcattcaagaacttcgtaattgtctgccttcctgggtcacacgccagcaa
atgctagagctgattgggagctcaggaggcgacattgttgaagcagtcagtaaattttat
gatcgtgaaacagaatttcgtggtcaagggattgcctctgcaactgctgtatctgtatcc
gagaccagcaaactgtgtgacactgcaacgccgacaaaagcaggttctgttcatgcaaat
attgacgtttcttcaagccgagatcatatttcacccaacccaagtaacatcatcattaaa
agtggcatttctcctggcaaaagagggaagaagattagtaataaagtaaacaagaaactc
aagttacagccgaagttggagtcatgtgggccaaaacaatcaatcataacaaggtttttt
agtaaagttttgcctgatgttacagcaagtggagagactggatccatgggtgaacaaaac
cctaaagataaaaatttgcccgatcatggcacccaaccctacaaggatgcagtagatcaa
tttcttcagataatagatggcaatgaatcattaaaaagctatgctgatagagttattcga
aaggcaaatggggatattagtagggcagtggatatacattactgtaacgaaggcaagtct
ggtgagaatgaaatggagttagtggctgaggcaaactcagttcagtccaacagttgtgtg
gacaactattccgctgaccaaaagataattgaattagggaagacaggactgttagctgat
tcatctgttctgctttcatcaccagataatatagatgcaacttctgtttcactaccgcca
gaaaaatacaaccctgtagagcatgcatgctggagtaatggacaacatgctccttattta
catcttgcacgaacctttgacttacttgagaatgaaaaaggcaagataaaggctacatct
atgctctgcaatatgttcagaagtttgcttgccttgtctcctgatgatgtgctgccttca
gtttatttgtgcaccaataagatagctgcagaccataaaaatgtggagctgaacattggt
ggaagtttggttacatcagcactggaggatgcatgcgggacaagtagatccaaaatcagg
gatatgtacaatgaattgggagatcttggtgatgttgctcaagcatgccgacagacacag
actttacttgcccctccttcaccacttctaataaaagatgtatttttggcgctctggaag
ataagtgtacaaacaggtagtggaagcagtgctcgaaagagaagcctgattgtgaatctc
atgcgttcttgcagagagaaagagatgaagttccttgtcagaacactggttcggaactta
cgtattggggcaatgatgaaaactgttctacctgctctggctcaagctgttgttctgaat
tccttccatagctgtaaccacaaaggaactatagaaagtttgatggataagcttcagcgt
cattcagcagctgtagtagaggcatacaatgtactgcccagtttggatgtggtcattcct
tctctcatgaaaagaggcattggattctcttcatcaactttgtcaatggttccaggaata
ccaatcaagccaatgcttgcaagaatcacaaatggtgttcagcaaacactgaagctgttt
gaaaataaagcttttacatgtgaatacaaatatgatggccagcgtgcacaaattcataaa
ctagttgatgggtccgtgcatattttttcacgaaatggggacgagtcgacttcgagattt
ccagatctgattaatataatcaatcaatcttgtaaacctgatgcattaactttcatactg
gatggagaggttgtcggagttgataggaagaatgggtgcaggctaatgtccttccaagaa
ttatcttcacgtgggagagggagcagagatgcatcaataacattggatagcataaaggtc
gacatttgcgtatttgtcttcgacatcatgtttgccaatggacaacagttgttaagcttt
cctctgaggagaagacgaaagtatttgaaagaaatgttttacgatgagaagttgggttac
ttcgaatatgccaaggaaatgacagttgaggcagaggatgcttgtttagccagtgaagcg
acattagcaaaaatgaactctttccttgaaaatgcatttgtttcctcatgtgaagggatt
atggtgaaatgtttagatgttgatgctggatatttgccatcaaagcgtatggatacttgg
ttaaaggtcaagcgagattacatagagggattgcgtgattcacttgatttggtcccaatt
ggagcttggcatggaaacgggagaaaggcaggctggtacagtccatttctcatggcatgt
tacaaccctgaaactgaagaacttcaaagcgtctgtcgtgttatgtctgggttttcagat
ttattctatacagagatgaaaagtttttattctggggacaagatcttggccaaaaaacca
ccttactatagaacagctgaggtgcctgatatgtggttctctccagagcttgtttgggaa
ataagaggtgcagactttacagtgtctccagttcaccaggccgctttgggtttagttcat
ccatcacgtggcatttccattcgattcccgagatacattcgcactgtgactgatagaaaa
ccagaggaatgtagcacagcttctgatatagctgaaatgtttcattctcagacgaggaag
atggacgtggcttctgaagatgggagctga

DBGET integrated database retrieval system