KEGG   Fragaria vesca (woodland strawberry): 101305015Help
Entry
101305015         CDS       T02666                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00040  Pentose and glucuronate interconversions
fve00051  Fructose and mannose metabolism
fve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101305015
   00051 Fructose and mannose metabolism
    101305015
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     101305015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C NCD3G AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 101305015
NCBI-ProteinID: XP_004308124
LinkDB All DBs
Position
LG7
AA seq 361 aa AA seqDB search
MGKGGMSHGDDQQENMAAWLVGINTLKIQPFKLPELGPHDVRIRMKAVGICGSDVHYLKA
MRVADFIVKEPMVIGHECAGIIEEIGSEVKHLVPGDRVALEPGISCWRCESCKEGRYNLC
PDMKFFATPPVHGSLANQVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRANVGPET
NVLVMGAGPIGLVALLAGRAFGAPRIVIADVDDYRLSVAKTLGADEIIKVSTNIQDVAEE
VVQIRKAMGAGVDVTFDCAGFDKTMSTALRATRPGGKVCLVGMGHDAMTLPLTSASAREV
DVIGIFRYKNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEEAFATSARGGNAIKVMFN
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagggagggatgtcacatggagatgaccaacaagagaacatggctgcttggctt
gttggtatcaacaccctcaagattcaacctttcaagctccctgaacttggacctcatgat
gtaaggattcggatgaaggctgttgggatatgtgggagtgatgttcactacctcaaggcc
atgagagttgcagattttattgttaaagagccaatggtaattgggcatgagtgtgctggg
atcatagaggaaattggaagtgaggtgaagcatctggtacctggtgaccgtgtggcacta
gagcccggtatcagttgctggaggtgtgaatcttgcaaagaaggtcgatacaatctatgc
ccggatatgaagttttttgctactccaccggttcatggttcactggcaaaccaggttgtc
catcctgcagacctgtgttttaaacttccagagaatgtgagtttggaagaaggggcaatg
tgtgagcccttgagtgttggtgttcatgcctgtcgccgagctaatgttggtccagaaaca
aatgttttggtcatgggagcaggacccatagggcttgttgcactgctagctggtcgtgct
tttggggcaccgagaattgtcattgcagatgtggatgactatcgtttatcagttgcaaag
actctaggtgcagatgagatcataaaagtttcaacaaacatccaggatgttgctgaagaa
gtggttcagatacgtaaagctatgggagctggagtggacgtgacctttgattgtgcaggc
tttgataaaaccatgtctacagctctgcgtgctactcgtcctggcggcaaagtttgcctt
gtgggaatggggcacgacgcgatgactctcccactcacttcagcttctgccagggaggta
gatgtgattggaattttccgatacaagaatacatggcctctatgcctggagtttttgaga
agtggtaagatcgatgtgaagcccctcataacgcatcggtttgggttttctcaaaaggag
gtggaagaagcctttgcaaccagtgctcgtggaggcaatgccattaaggtcatgtttaac
ctgtaa

DBGET integrated database retrieval system