KEGG   Fragaria vesca (woodland strawberry): 101307132Help
Entry
101307132         CDS       T02666                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00620  Pyruvate metabolism
fve00710  Carbon fixation in photosynthetic organisms
fve01100  Metabolic pathways
fve01200  Carbon metabolism
Module
fve_M00168  CAM (Crassulacean acid metabolism), dark
fve_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
fve_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
fve_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    101307132
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101307132
Enzymes [BR:fve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     101307132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 101307132
NCBI-ProteinID: XP_004303182
LinkDB All DBs
Position
LG6
AA seq 961 aa AA seqDB search
MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQDC
YELSAEYEGKQDPKKLEELGNVFTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFVDEANATTESDIEETFKKLVGQLKKSPQEVFDELKNQTIDLVLTAHPTQSVRRS
LLQKHARVRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNEELLARAHELHRSSRKDAKHYIEFWKQIP
PNEPYRVILGGVRDKLYNTRERARQLLSSLTSDIPEDTTFTSVEQFLEPLELCYRSLCSC
GDKAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDTITKHLGLGSYREWPEKQR
QEWLLSELSGKRPLFGADIPKTEEVSDVLETFKVISELPSDNFGAYIISMATAPSDVLAV
ELLQRECHVKKPLRVVPLFEKLADLEAAPAAVARLFSIDWYKNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELVKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPVSPKPEWRALMDEMAVVATE
EYRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKQAIEKDAKNLQMLREMYNQWPFFRVTIDLIEMVFAKGDPGIAALYDK
LLVSEDLWSFGERLRTNYEDTKRLLLQVAGHKALLEGDPYLRQRLVLRDSYITALNVCQA
YTLKQIRDPNYLVQVRPSKEPASKPAAELVNLNPTSEYAPGLEDTLILTMKGIAAGMQNT
G
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaggaatttggagaagatggcttcaattgatgcgcagctgaggctgttggca
ccgggcaaggtgtctgaggatgacaaactcatcgagtatgatgctttgttgttggatcgc
tttcttgacattcttcaggatttacatggggaggatctcagagaaacggttcaagattgt
tatgagctatccgcggaatatgaaggaaagcaggaccctaaaaagttggaggaacttgga
aatgtgtttacaagtttggatcctggtgactccattgttgtggccaagtccttttcccac
atgcttaacttggccaatttggctgaagaagtccagatcgcctatcggagaaggataaag
ttgaagaagggagattttgttgatgaagcaaatgctacaacggagtcagacattgaagag
acattcaagaagcttgttgggcaactgaagaagtccccacaagaagtttttgatgaattg
aagaaccagactatagatttggttctaaccgcacatcctactcagtctgttcgcagatct
ctgctgcaaaagcatgcaagggtaagaaattgtctgacacagttgtatgccaaggatatt
acacctgatgataaacaagaactcgatgaggctctacaaagggagattcaagctgcattt
cgcactgatgaaatccgaaggactcctccaacccctcaagatgagatgagggcaggaatg
agctacttccatgagacaatttggaaaggtgtgccaaaattcttacgacgagttgacact
gcgttgaagaacattgggataaatgaacgtgttccgtacaatgcccctctcattcaattt
tcttcttggatgggtggggatcgtgatggaaatcccagggtcactccagaagttacaagg
gatgtatgcttattggctagaatgatggctgctaacttgtatttctcccagatagaggat
cttatgtttgagttatctatgtggcgttgcaacgaagagcttcttgctcgtgctcatgaa
cttcataggtcttcaaggaaggatgcaaaacactacatagagttttggaaacaaattcct
ccgaacgagccatatcgtgttattcttggtggtgtgagagacaagctctacaatacacgt
gaacgtgctcgtcaactattatccagtctaacctctgacattcctgaggatacaactttt
actagtgttgaacagttcctggagcctcttgaactgtgttaccggtcactctgttcctgt
ggtgacaaggcaattgctgatgggagccttcttgatttcttacggcaagtttctactttc
ggcctttctcttgtgagactagacatacggcaagaatcagacaggcacactgatgtcatt
gatactatcacaaagcacctgggccttgggtcttatcgagaatggcctgagaaacaaagg
caagaatggttgttgtctgagctcagtggaaagcgccctctttttggcgctgatattccc
aaaaccgaagaagtttctgatgtattggagacattcaaagtaatatcagaacttccctca
gacaactttggtgcctatatcatatcaatggcaacagccccatccgatgtacttgctgtt
gagcttttacaacgtgaatgccatgtgaaaaagccactaagggttgtaccgttgtttgag
aagcttgctgatttagaggctgctcctgctgctgttgctcgcctcttttctatagattgg
tacaaaaaccggatcaatgggaagcaagaagtcatgatagggtattcagattcaggaaag
gatgctggccgtctatctgcagcatggcagctatacaaggctcaagaagagctcgtaaag
gttgcaaaacaatatggagttaagctaaccatgtttcatggccgaggtggaacagttgga
agaggagggggacccactcatcttgctatattgtctcagccacctgagacaattcatggt
tcgctccgtgtgaccgttcaaggagaagttatcgaacaatcatttggagaggagcacttg
tgttttagaacactccagcgtttcacagcagctacactagagcatggcatgaatccccca
gtttcaccaaagccagaatggcgtgcactcatggatgagatggcagttgttgctacagag
gaataccgttcaattgtttttcaggaacctcgttttgttgaatactttcgcctcgcaaca
ccagagatggagtatggtcggatgaacattgggagtcgtccatcaaagcgaaagccaagt
ggaggcatcgaatcacttcgagcaatcccctggatctttgcatggacccagacaagattt
catttaccagtgtggcttggttttggggcagcatttaagcaagccatagagaaggatgca
aagaatcttcagatgcttcgggagatgtataatcagtggccgttcttcagagtcaccatt
gatttgattgagatggtgtttgccaagggagacccaggtattgcagcactttatgacaag
cttctggtgtcagaagacctatggtcgtttggggagcgactgaggaccaactatgaagat
actaaacgcctcctactccaggttgctgggcacaaagctcttctggagggagatccttac
ttgaggcagagacttgttcttcgtgactcgtatattacagcacttaatgtgtgccaagcc
tatacactgaagcagatccgtgaccccaactaccttgttcaagtaaggccgtcaaaggaa
ccagcaagcaagccagcagcagagctcgtcaatcttaacccaacaagcgaatatgctcca
ggtctagaggacacacttattttgaccatgaagggtatagctgctggaatgcagaacact
ggttga

DBGET integrated database retrieval system