KEGG   Fragaria vesca (woodland strawberry): 101307336Help
Entry
101307336         CDS       T02666                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:fve00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101307336
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101307336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101307336
NCBI-ProteinID: XP_004288233
LinkDB All DBs
Position
LG1
AA seq 152 aa AA seqDB search
MAKGVAVLCSSEGVAGTILFTQEGDGPTTVTGNITGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPAGKEHGAPEDENRHAGDLGNITVGDDGKACFTIVDKQIPLTGPHSIIGRAVVVHG
DPDDLGKGGHELSKSTGNAGGRIACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagggcgttgctgtgctttgctccagtgagggtgttgctggaactatcctcttc
acccaagagggagatggcccaactactgtgaccggaaacattactggcctcaagcctggg
cttcatggtttccatgttcatgctcttggggacaccacaaatggttgcatgtcaactgga
ccacacttcaatcctgctggcaaagagcatggtgctcctgaagatgagaatcgtcatgct
ggtgatcttggaaatatcactgttggggatgatggaaaggcttgcttcacaattgttgac
aagcagattcctctcactggaccacactctatcattggtagggctgttgttgtccatgga
gaccctgatgatcttggcaagggtggacatgagcttagcaaatccactggaaatgctggt
ggcaggatagcttgtggtatcattggtctgcagggatga

DBGET integrated database retrieval system