KEGG   Fragaria vesca (woodland strawberry): 101308039Help
Entry
101308039         CDS       T02666                                 

Definition
(RefSeq) probable S-adenosylmethionine carrier 2, chloroplastic
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
KEGG Orthology (KO) [BR:fve00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fve02000]
    101308039
Transporters [BR:fve02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   101308039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 101308039
NCBI-ProteinID: XP_004290480
LinkDB All DBs
Position
LG2
AA seq 303 aa AA seqDB search
MQPKSCQPHPPDVITCKTSKDPNDSPFDFLGVFCDSIIAGGAAGVVVEAALYPIDTIKTR
LQVAHAGGKIMLKGLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKSLPENLSALAHLTA
GAIGGAASSIVRVPTEVVKQRMQTAQFASAPDAVRLIIAKEGFKGLYTGYGSFLLRDLPF
DAVQFCIYEQLRIGFKLAARRDLNDPEVAMVGAFAGAITGAITTPLDVIKTRLMVQGSEN
QYRGICDCVRTIMREEGNHALWKGIGPRVLWIGIGGSIFFGVLERTKQILEQRRIKNEDS
KHY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgaaatcttgtcagccgcatccacccgatgtgataacctgcaaaacgagtaaa
gacccaaatgactctccattcgatttcttgggtgttttctgcgatagtatcatagctggt
ggtgctgctggtgttgttgtggaagccgcattgtacccaattgacactataaaaactcga
ttacaggttgctcatgctgggggaaagatcatgttgaagggtctgtattcgggattggct
ggaaaccttgctggtgttttaccggcttctgctatatttgttggtgtctatgaacctaca
aagcagaaattgctgaagtctctcccagaaaatctcagtgctttagctcatctgactgca
ggtgctattggaggtgctgcttcttctattgtacgggtgccaacagaggttgtcaagcaa
aggatgcaaactgcgcagtttgcttctgccccagatgctgttcgccttattattgctaag
gagggtttcaaaggtctttacacggggtacggatcattcctattgcgagatttaccattt
gatgcagttcagttttgcatctatgagcaacttcgaataggatttaaactagcggcacga
agagatctgaacgaccctgaggttgctatggttggtgcttttgctggtgcaataactgga
gctataactactcctcttgatgtgataaaaacgagattaatggttcagggatcggaaaac
cagtaccgaggaatttgtgactgtgttaggaccataatgagagaagaaggaaatcatgct
ctctggaagggcattgggccacgagtactgtggataggtattggaggttcaattttcttt
ggtgttcttgaaaggacgaagcaaatacttgagcaaaggcgcatcaagaatgaggattcc
aagcattactga

DBGET integrated database retrieval system