KEGG   Fragaria vesca (woodland strawberry): 101308249Help
Entry
101308249         CDS       T02666                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00010  Glycolysis / Gluconeogenesis
fve00051  Fructose and mannose metabolism
fve00052  Galactose metabolism
fve00500  Starch and sucrose metabolism
fve00520  Amino sugar and nucleotide sugar metabolism
fve01100  Metabolic pathways
fve01110  Biosynthesis of secondary metabolites
fve01200  Carbon metabolism
Module
fve_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fve_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101308249
   00051 Fructose and mannose metabolism
    101308249
   00052 Galactose metabolism
    101308249
   00500 Starch and sucrose metabolism
    101308249
   00520 Amino sugar and nucleotide sugar metabolism
    101308249
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101308249
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fve04131]
    101308249
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101308249
Membrane trafficking [BR:fve04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101308249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101308249
NCBI-ProteinID: XP_004291365
LinkDB All DBs
Position
LG2
AA seq 494 aa AA seqDB search
MSVTAATSPSVGSFHLCRRSTRPAGLPRFRMTVRSTAVSVTPLVTKLRKECATPLPLLRH
VADAMAADMRAGLAGDGGSDLKMILSYVDSLPTGNEKGLFYALDLGGTNFRVLRVQLGGK
EERVIATEFDQVSIPKDLMFGTSEELFDFIASGLAKFAENEGNKFHLPAGTKREIGFTFS
FPVKQTSVDSGILIKWTKGFSVSGTAGRDVVACLNEAMERLGLDMRVSALVNDTVGTLAG
ARYWDDDVMVAVILGTGTNACYVERVDAVPKLQNHASSSGSTIINTEWGAFSNGLPLTEF
DRDMDAASINPGEQIFEKTISGMYLGEIVRRVLLKMAEADALFGDPILEKLSTPFALRTP
DVCAMQQDTSDDLQDVGSILYNVAGVESNLSARKIVVEVCDTIVKRGGRLAGAGIVGILQ
KMEEDSKGVIFGKRTVVAMDGGLYENYPQYRTYLSEAVTELLGDDIAKNVVIEHSKDGSG
IGAALLAAANSKYL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttacagctgccacgtcaccctcggtcgggtccttccacctctgccgccgatca
actaggccggcgggtctccctcggttcaggatgaccgtccgatctactgccgtttctgtc
actcctctggtgaccaagttacgcaaggagtgtgccactcctttgcctttgctgcgccac
gtggcggacgccatggccgccgatatgcgcgctggtctcgccggggatggcgggagtgat
ctcaagatgatactcagctacgttgatagcctcccaactgggaatgagaagggcttgttt
tatgcactggatcttggaggcacaaacttcagggtgctgagagtacaactaggaggcaag
gaagagcgtgtgatcgccactgaattcgatcaagtttcgatccccaaggatcttatgttt
ggcacttccgaggaactattcgattttattgcttccgggttggcaaagtttgcagaaaat
gagggtaacaagtttcaccttccagctggtacaaaaagagagattggattcacattttca
ttccctgtgaagcagacctcagttgactctggcatactaattaaatggacaaagggcttt
tcagtctctggaacggcaggaagagatgttgttgcttgtttgaatgaggctatggaaagg
ctaggattagatatgcgtgtgtctgccctggttaatgatactgttggaacattagctgga
gcaagatactgggatgatgatgtcatggttgctgtcattttaggtactggaaccaatgct
tgctatgttgagcgcgtcgatgcagttcctaaactacagaatcatgcgtcttcttctgga
tctacgattattaacactgagtggggagcattctcaaatggtcttccgttaactgaattt
gatagagatatggatgctgctagtatcaaccccggtgagcagatctttgagaaaacaatc
tctggaatgtatcttggtgaaattgtaagaagagtactactgaagatggctgaagcagat
gcgctctttggtgatccaatcctagaaaaactatcaacaccttttgcactcaggacccca
gatgtatgtgctatgcagcaggatacgtctgatgatcttcaagatgttggatcaatccta
tacaatgtagcaggggttgagtccaatttaagtgcaagaaagattgtggtggaggtatgt
gacaccattgtgaagcgaggagggcgcttagctggtgcaggaatagtagggatactgcaa
aagatggaggaggattcgaaaggtgtcatcttcggcaagagaacagttgtcgctatggat
ggaggcttgtatgagaactaccctcaatacagaacatatctcagcgaggctgtcaccgag
cttctaggggatgatattgcaaagaatgttgtgatagagcattcaaaagatgggtctggt
ataggggctgctcttttggctgctgcaaattccaagtatctatga

DBGET integrated database retrieval system