KEGG   Fragaria vesca (woodland strawberry): 101308461Help
Entry
101308461         CDS       T02666                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00010  Glycolysis / Gluconeogenesis
fve00020  Citrate cycle (TCA cycle)
fve00620  Pyruvate metabolism
fve01100  Metabolic pathways
fve01110  Biosynthesis of secondary metabolites
fve01200  Carbon metabolism
Module
fve_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101308461
   00020 Citrate cycle (TCA cycle)
    101308461
   00620 Pyruvate metabolism
    101308461
Enzymes [BR:fve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     101308461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DciA
Motif
Other DBs
NCBI-GeneID: 101308461
NCBI-ProteinID: XP_004298290
LinkDB All DBs
Position
LG4
AA seq 479 aa AA seqDB search
MASSPFLSKSPISFSSSVSTSLPWRPSLSSSSSAAFRSKPRRRSLTVQSKIREIFMPALS
STMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGESAPVGA
AIGILAETEAELEEAKAKAKTDSGAAKPEAAAVTPSTPPVTANPAPAIAQPAPAATSAAP
AGPRKTVATPFAKKLAKQHKVDIAAVVGTGPFGRITPADVEAAAGIQPKKSVAVESATAA
AAPSKPAAAPALPLLPGSTVVPFTTMQAAVSKNMIESLSVPTFRVGYPVNSDAIDALYAK
LKSKGVTMTALLAKAVALALAQHPVVNASCKDGKSFYYNSSINIAVAVAIDGGLITPVLQ
DADKVDLYLLSQKWKELVGKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAI
MAVGASKPTVVADADGFFSVKSKMLVNVTADHRIVYGADLAAFLKTFAKIVENPESLTL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctctcctttcctctccaagtcccccatttccttctcctcttccgtctccacc
tccctcccatggcgcccttctctctcctcctcctcctccgccgcattccgctccaagccc
cgccgcaggtccctcaccgtccaatccaagatcagggagatcttcatgcccgccctcagc
tccaccatgaccgagggcaagatcgtctcctggatcaaatccgaaggcgacgtcctctcc
aagggcgagagcgtcgtcgtcgtcgagtccgataaagccgacatggacgtcgagactttc
tacgacggcatcctcgccgcgattgtcgtcggcgagggcgagtccgcccccgtcggcgcc
gccatcgggattctcgccgagactgaagccgagctcgaagaggccaaggccaaagccaag
actgattccggcgccgcgaagcccgaggccgctgccgttacgccctctactcctcctgtt
actgccaatcctgctcctgctattgcgcagcctgctcctgctgccacgtcagctgcgccg
gctgggcccaggaagactgtggccactccctttgcgaagaagctggctaagcagcacaag
gtggacattgccgccgtggtggggaccggcccgttcgggagaattactcctgctgacgtg
gaggctgccgcgggaattcagcccaagaaatccgtggctgtagagtctgctacggctgcg
gcggctccgtccaagcctgctgccgccccggcattgcctctacttccaggctcgactgtc
gtgcctttcaccacaatgcaggctgcagtttcgaagaatatgattgagagtctctcggtg
ccgactttccgggtgggttatccggtgaacagcgatgccatcgatgcgctgtatgcgaag
ttgaaatcaaagggtgtgaccatgactgccttgcttgccaaggcggttgctctggcgctc
gctcagcacccggttgtgaatgccagctgcaaagacggaaagagcttttactacaacagt
agcataaacatcgccgttgctgtggctattgacggcgggttgataacccctgttcttcag
gatgcagataaggtggatttgtatttgttatcccagaaatggaaagagctggtgggaaag
gcccgctcaaagcaacttcagccccatgagtacaactcaggaactttcactctctccaat
ttgggtatgtttggagtggacaggttcgatgctattcttcctccaggccagggtgctatc
atggctgttggagcttcaaaacccaccgttgtagctgatgcagacggattcttcagtgta
aaaagtaaaatgctggtgaatgtaacagcagatcaccgaattgtttatggagctgatttg
gctgccttcctaaagacatttgcaaagattgttgagaacccagaaagcctgacattgtag

DBGET integrated database retrieval system