KEGG   Fragaria vesca (woodland strawberry): 101309574Help
Entry
101309574         CDS       T02666                                 

Definition
(RefSeq) uncharacterized LOC101309574
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00562  Inositol phosphate metabolism
fve01100  Metabolic pathways
fve04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101309574
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101309574
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fve01009]
    101309574
Enzymes [BR:fve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101309574
    3.1.3.48  protein-tyrosine-phosphatase
     101309574
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     101309574
Protein phosphatases and associated proteins [BR:fve01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    101309574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 Y_phosphatase3 DSPc Y_phosphatase PTPlike_phytase LIM_bind
Motif
Other DBs
NCBI-GeneID: 101309574
NCBI-ProteinID: XP_004306107
LinkDB All DBs
Position
LG6
AA seq 418 aa AA seqDB search
MGTKLTKEQAVPLPVPGKLESLTLQHHLINCVSNSFYIRNLVSKQRRRMLVAGYDLDMSY
ISDRILAMSFPSERIRAMFRNPLWQVKSVLDMRHPEHYKIYNLCIEEQYDPSHFYGRVER
FPFDDNHVPPLAMVKLFCESVQSWLNSDPENIAVIHCMAGKGRTGLMVCAYLVYCGMSAE
EGLQLYAHRRTTNNEGVSIPSQRRYVGYWESCLSFPSEADEGPPEVKLPQPCSRELRRIR
FYDTLNIDKIFFVVSELREIPGQRYRPSSEVSRSSCKKIKKGYQRTSSPRYYLSFTEGDG
EDKKPDPDEPRVVVQMDTESSILYQKACLEYYFDNPVQVTGDVRVIFYQKMNGGRLFYAC
FNTAFIKNSLLQLTVRDLDKIGKKGRSICGPKFCLELLFGPANAKHSPSTPRHSRDVL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgaagttaacaaaggaacaagccgtgccgttaccggtgccaggaaagcttgaa
agcctaactttacaacaccatctgatcaattgcgtaagtaacagcttttacatccgaaac
ttggtgtccaagcaacggaggcgaatgcttgttgctggctatgatcttgacatgtcttac
atttcggaccgcattttggcaatgtcgttcccctcggagcgaatacgtgcaatgtttcga
aatcctctttggcaggtcaagtctgtgcttgatatgaggcatccagaacattacaagatc
tataacctctgcattgaagagcaatatgatccatctcatttctatggccgtgtggagagg
tttccttttgatgataaccatgttccacctcttgcaatggtcaagcttttctgcgaaagt
gtgcaatcatggctcaacagtgacccagaaaatattgctgttatacactgcatggcagga
aaaggtcgaacaggcttaatggtatgtgcgtatctagtctactgtgggatgtcagcagag
gaaggccttcaactctatgctcatagacggaccaccaataatgaaggagtctcgatacca
agccaacgtcgttacgtagggtactgggaaagttgtctctctttcccttcagaagccgat
gaaggacctcctgaagtcaagttacctcagccgtgtagcagagaactgcgaagaatccga
ttttatgacacacttaacattgataagatcttctttgtggtttctgagttgcgagagatt
ccgggccagagatatcgtccatcttcagaagtttctaggagttcttgcaaaaaaatcaag
aaagggtatcagagaacaagcagtcctcgctattatctctctttcaccgaaggtgatgga
gaagacaagaaaccagatccagatgaacctcgtgttgttgttcaaatggatacagaaagt
tccatactataccagaaggcatgtcttgaatattactttgataatcctgtgcaggtaacc
ggagatgtgcgtgtcatattctatcaaaaaatgaatggagggcgtctcttctacgcttgc
ttcaacactgctttcattaagaacagtttgctacagctcacagttcgggatttggataaa
attgggaagaaaggaagatcaatatgtggccctaaattctgcttggagttgctatttggt
cctgcaaatgcgaaacactcaccctcaactccacgtcacagtcgtgatgtgctgtga

DBGET integrated database retrieval system