KEGG   Fragaria vesca (woodland strawberry): 101310997Help
Entry
101310997         CDS       T02666                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
KEGG Orthology (KO) [BR:fve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fve01001]
    101310997
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101310997
Protein kinases [BR:fve01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101310997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Pkinase_C RIO1 Haspin_kinase Kdo APH FTA2
Motif
Other DBs
NCBI-GeneID: 101310997
NCBI-ProteinID: XP_004299621
LinkDB All DBs
Position
LG5
AA seq 447 aa AA seqDB search
MVSSSQNSNKSLHSLLAARLTNLTIPPSSSSSSPPQDFDFNDVFGPPTASSDAAPPPLLV
IHNRSHSFVGPSPRFTPTSSSFLRPFAAESDSDEDENDAVSEKDEEPAVRKFGPSDFEIL
RVVGRGAFGKVFQVRKKRCDGEEDGDGLYAMKVMKKETVIKKNHVDYMKAERDILTKVVH
PFIVQLRYSFQTKSKLYLIMDFMNGGHLFYHLYRQRIFSEDQARFYTAEIVSAVSHLHKC
GIVHRDLKPENVLMDADGHVMLTDFGLAKEIDEDSRSNSMCGTTEYMAPEILLSKGHNKD
ADWWSIGILLYEMLSGQPPFTHANRKKLQERIIKEKIKLPPYLTTDAHSLLKGLLQKEPS
QRLGSGPSGGDDIKRHKWFKTINWKKLEARELLPKFKPDVTGKDCTANFDRCWTTMPLDD
SPAPTPTAGEHFQGYTYVAPNTWLSSV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcctcatctcagaacagcaataaaagcctccattccctcctcgccgcaaggctc
accaacctcacaatcccgccttcctcctcctcctcatctccgcctcaagacttcgacttc
aacgacgtcttcggccccccaaccgcctccagcgacgccgcgccgccgcctttgctagtc
atccacaaccgctcccactccttcgtcggcccctccccgcgcttcacccccacctcctcc
tccttcctccgccccttcgccgccgaatccgactctgatgaagacgaaaacgacgccgtt
tccgagaaagatgaggaaccggcggtgcggaagttcgggccttcggattttgagattctc
agagtcgtcgggaggggcgcgttcgggaaggtgtttcaggtgaggaagaagaggtgtgat
ggtgaggaagatggcgatgggctttatgctatgaaggttatgaagaaggagactgtgatt
aaaaagaaccatgtggattacatgaaggctgagagagatattctcactaaagttgtccac
cctttcattgttcagctccgctactcttttcagaccaagagtaagctgtacctgattatg
gatttcatgaacggagggcatctgttctatcatttgtaccggcagcggatattcagtgag
gatcaggcgaggttttatactgcggagatagtgtctgctgtttcacatcttcacaagtgc
gggattgtgcatcgggaccttaagccggaaaatgttctcatggatgctgatggccatgtg
atgctgacggattttggactagcaaaggaaattgatgaggatagcagatcaaattcaatg
tgtggaaccacggaatatatggctccggaaattttgctgtctaaagggcacaacaaagat
gcagattggtggagcattggcatacttttgtatgagatgctaagtggccagccgccattt
acgcatgcaaatagaaaaaaacttcaggagagaatcatcaaagagaaaattaaacttcca
ccttaccttaccactgacgctcactctttgctcaaaggattgctacaaaaggaaccatct
caaaggttaggcagtggccccagtggaggtgatgatatcaaacgtcataaatggtttaaa
acaattaactggaagaagttggaggcgagagaactgctcccaaagttcaagccagatgtg
actggaaaagactgcacggccaattttgaccggtgctggacaacaatgcctctagatgac
tcaccagctcctacaccaacagcgggtgagcattttcagggatatacttatgtggcacct
aacacttggctttcatctgtataa

DBGET integrated database retrieval system