KEGG   Fragaria vesca (woodland strawberry): 101311915Help
Entry
101311915         CDS       T02666                                 

Definition
(RefSeq) putative tyrosine-protein phosphatase TPTE
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00562  Inositol phosphate metabolism
fve01100  Metabolic pathways
fve04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101311915
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101311915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fve01009]
    101311915
Enzymes [BR:fve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101311915
    3.1.3.48  protein-tyrosine-phosphatase
     101311915
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     101311915
Protein phosphatases and associated proteins [BR:fve01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    101311915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3 PTEN_C2 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 101311915
NCBI-ProteinID: XP_004289204
LinkDB All DBs
Position
LG1
AA seq 513 aa AA seqDB search
MDEKSSDPSPQPAAVPYAQDNATQNAERPKGVSGALGSFTKGILNRSQSAVKAVQVKARH
LVSQNKRRYQEGGFDLDMTYITENIIAMGFPAGDISSGFFGYVEGFYRNHMEEVIRFFET
NHKGHYKVYNLCSERLYDASRFEGKAASFPFDDHNCPPIQLIGSFCQSAHSWLKEDIENV
VVVHCKAGMARTGVMICSLLLYLKFFPTAEEAMYYYNNKRCVDGKAMVLPSQIRYVKYFD
IISRKFNGECPPRRCMLRGFRIHNCPYWVRPCITVSDHNGILFSSRKHSKTKDLMPEDFW
ISARKKGIIVFALPGEPGLAELAGDFKIYFHDRHGDFYCWLNTTTENNRIFLKADDLDGF
DKRKLPSPRFQVEVVLVDYRGTSTVPKAESLSRKPDGSSNDASASSGGDAANLNQGKKDG
DDVFSDSEGEESGDRKGRLAEANIKAGTTAPDHSSNTTGKQMETSAQTVDNPGNGSFQKQ
TSDRAGNSGAEDIRAIAADASVFSFGDEDFDSE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggatgagaaatccagtgacccatcacctcaacctgctgccgttccatatgctcaagat
aatgccactcaaaatgctgagaggccaaagggggtttctggggctcttggatcgtttacg
aaaggtatacttaacagatcgcagtctgcagtcaaggctgtgcaggtcaaggctcgccat
ctcgtctctcaaaacaaaagaagataccaggagggtggttttgatttagatatgacatat
attactgaaaatataattgctatgggtttcccggctggagatataagttctggctttttc
ggatatgttgaggggttttatcggaatcatatggaagaagtgatcagattttttgaaact
aatcacaagggacattataaagtatacaatctttgttcagagaggttatatgatgcatcg
cgatttgaggggaaggctgcaagtttcccatttgatgatcataactgccccccaattcaa
cttattggatccttctgtcaaagtgctcattcatggttaaaggaggatattgaaaatgtt
gtggttgttcattgtaaagctggtatggcaaggacaggagtaatgatatgtagccttctc
ctataccttaagttctttcctacggctgaggaggccatgtattactataacaataaaaga
tgtgtagatggaaaggctatggttcttccgagtcagattaggtacgtgaaatattttgac
attatctcaagaaaattcaatggagaatgtcctcctcgaaggtgcatgctcaggggattc
cggattcacaactgcccttattgggttaggccctgcattacagtctctgatcataatgga
attttgttctcatcaagaaagcactcaaaaacaaaagatctaatgccagaagatttctgg
atcagtgcacggaagaaagggataatcgttttcgctctaccaggggagcctggtcttgca
gagttagcgggggatttcaaaatctatttccatgatcgccatggggatttctattgctgg
ttaaatacgacgacagaaaacaacagaatattcttaaaagcagatgatctcgatggtttt
gacaagagaaaattaccgtctccaagattccaggttgaagtggtccttgtagactatagg
ggcacttctacagtacctaaagcagagtctttaagtagaaaacccgatggtagctcaaat
gatgcctctgcttcaagtggtggtgatgcagccaatctgaatcaaggaaaaaaagatggt
gatgatgtattttcggatagtgagggagaggagtctggggatagaaagggcaggctagca
gaagctaatatcaaagctgggactacagcacctgatcattcgtccaacacaacaggaaag
caaatggaaacttcagctcaaactgtggataatccaggcaatggatcttttcaaaaacaa
acttctgacagggcaggaaattctggagcagaagatattagagcaatagctgctgatgcc
tcagttttctcttttggggatgaagattttgacagtgaatga

DBGET integrated database retrieval system