KEGG   Fragaria vesca (woodland strawberry): 101312287Help
Entry
101312287         CDS       T02666                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00564  Glycerophospholipid metabolism
fve01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101312287
Enzymes [BR:fve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     101312287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 Pyr_redox GIDA NAD_binding_8 HI0933_like 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 101312287
NCBI-ProteinID: XP_004307359
LinkDB All DBs
Position
LG7
AA seq 629 aa AA seqDB search
MATATRLRRLGAAAAIAAAASGAFLIQPSVTAADSSGANPVAEVRQRISDRNGSVPPRAA
QESALIGAGAGNPLDILVIGGGATGAGVALDAATRGLKVGLVEREDFSSGTSSRSTKLLH
GGVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFGWFDVVYYWAG
LKMYDLVAGFRLLHVSRYYSAQESVELFPTLLRNGKDKSLKGTVVYYDGQMNDSRLNVGL
ACTAAMAGAAVLNHAEVIGFLKDKKSNRTIGARIRDNLTGEEFETYAKVVVNAAGPFCDS
VRKLTDKDVKPMICPSSGVHIILPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTEITLLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLATDPSAKNTESISR
DHVVCEDYPGLVTITGGKWTTYRGMAEDAVNAAIKSGKLTPQSGCVTSNLPIVGGDGWDP
ASFTVIAQQYTRMKRSHGKVVPGVMDTAAAKHLSHAYGTFAERVAAIAQNENLGKRLAHG
YPYLEAEVAYCARNEYCESAIDFIARRSRLAFLDTDAAGRALPRVIEILATEHNWDNSRQ
KQELEAARKFLETFKSSKNARFHDGKHNE
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccacgcgcctacggcgtctgggagccgcggcggcgattgcggccgcggcc
agcggcgccttcctcatccaaccgtcagtcacggccgcggacagcagcggtgcaaacccg
gtcgctgaggttcggcagaggatcagcgaccggaacggctctgtgccgccgagggcggca
caggagtcggctttgatcggcgccggcgccgggaacccgctcgacattcttgttatcggc
ggcggtgccaccggcgctggggtcgcgcttgatgctgctaccagagggctgaaagttggc
cttgttgagagggaggacttctcttctggaacttcgtccaggtccaccaagcttcttcat
ggaggtgttcgctatttggagaaagctgtttttaatctagactatggccagctgaagttg
gtgttccatgcgcttgaggagcgtaaacaggttattgataatgcgccgcacctgtgccat
gctctgccgtgcatgacgccatgttttggttggtttgatgtggtgtattactgggcgggg
ttgaaaatgtatgatcttgtggcaggattccgcctgctacatgtgtcgagatattactct
gcacaggagtctgttgagctgtttcctacactgttaaggaatggtaaagataaaagcttg
aagggcactgtggtgtattatgatgggcagatgaatgattctcgtcttaatgttggattg
gcgtgcactgctgctatggctggtgcagcagtgcttaatcatgcggaagtgattggtttt
ctgaaggataagaaaagcaatcggacaatcggtgcgagaatccgagacaacttgacagga
gaagagtttgagacatatgcaaaagttgttgtcaatgctgctggaccgttttgtgattct
gtaaggaagttgactgataaagatgtaaaacctatgatatgtccaagcagtggtgtgcac
attatacttcctgattattattctcccgagggtatgggattgattgtccctaaaactaaa
gatggacgtgttgtcttcatgctgccatggttgggacgaacagttgctggcaccacagat
tctaacacagagattactctgcttcctgaaccacatgaggatgagattcaattcatattg
gatgccatttctgattaccttaatgtcaaggtacggcgtactgatgttctctctgcgtgg
agtggtattcgcccattggcaacagatccatctgcaaaaaacaccgagagtatctctaga
gatcacgttgtatgtgaagattatcctggacttgtcacaatcactggtgggaagtggact
acataccgtggcatggcagaagatgcagttaatgcagctataaagtcgggaaagctgacc
ccacaaagtggatgtgtaacctcaaacctacctattgtcggtggagatggatgggaccct
gcatctttcaccgttattgctcagcaatatacgcgtatgaagaggagtcatggtaaagtt
gttcctggagtaatggacactgcagcagcaaagcatctgtcccatgcgtatggtactttt
gctgaacgggttgctgccattgctcagaatgaaaacttggggaagcgacttgcgcatggg
tatccttatctagaggcggaagttgcttactgtgcacgaaatgagtattgtgaatcagcc
attgatttcattgctcggagatctcggcttgctttccttgatactgatgcggcaggcagg
gcattgccacgcgtaattgaaatattggcaactgaacacaattgggacaattcaagacag
aagcaagagttagaagcggccaggaaattcttggaaacattcaaatcttccaaaaatgca
cggtttcatgatgggaaacacaatgagtag

DBGET integrated database retrieval system