KEGG   Fragaria vesca (woodland strawberry): 101313251Help
Entry
101313251         CDS       T02666                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase YODA
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
fve  Fragaria vesca (woodland strawberry)
Brite
KEGG Orthology (KO) [BR:fve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fve01001]
    101313251
Enzymes [BR:fve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101313251
Protein kinases [BR:fve01001]
 Serine/threonine kinases: STE group
  STE11 family
   101313251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo NEMO Pkinase_fungal Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 101313251
NCBI-ProteinID: XP_004288333
LinkDB All DBs
Position
LG1
AA seq 618 aa AA seqDB search
MPAWWGRKSTKTTKTDPPEKKSLNPYSNRNSYVVKSPPARSTNTSFDEPSPRVVSKDLGT
ASSGFSGFESDGGSKGHPLPRPSVSSPHGGGPGNDQGVGLGSASGSVSSGTSSVSSDDQP
VLAAFRVNGEPKFSMMPRSPGPGSRGPTSPTSPLHARLGGMSLESPTGKLDDGKSVCHPL
PLPPGSPTSPSSLTNNRTSSGVIESIACALSKWKKGRLLGRGTFGHVYVGFNSESGQMCA
IKEVRLITDDQSLKECLKQLNQEINLLSQLSHPNIVRYHGSELGEEALSVYLEYVSGGSI
HKLLQEYGAFKEPVIQNYTRQILSGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMA
KHITNCASMLSFKGSPYWMAPEVVMNTNGYSLAVDIWSLGCTILEMATSKPPWSQYEGVA
AIFKIGNSKDMPDIPDYLSHDAKNFVRLCLQRNPSERPTASQLLDHPFIREQMTTRSSNI
KLTKDAFPYAFDGSRTPPILELHSNRTSITLGDADHIMKPSVTTSRAIRSPRDNARMITS
LPVSPCSSPLRQYGPAHKSCFLSPPHPTYAMMGQNNYNLNEYSSYTTRPNTSYTLEPWRE
SPLLRPQTPGGSPRTRPI
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgtggtggggaaggaagtcaaccaagaccaccaagaccgacccgccggagaag
aagtcactcaacccttacagcaaccgcaactcctacgtcgtcaagtcgccgccggccagg
tccaccaacaccagcttcgacgagccgtcgccgagggtggtgagcaaggatttggggacg
gcgtcgtccgggttctcgggtttcgagtccgacggcggctctaaaggacacccgctgccg
cggccgtcggtgtcgtcgccgcacggaggaggaccgggaaatgatcaaggggtggggttg
ggatccgcgtcgggatcggtttcgagtgggacgtcgtcggtctcgtcggacgaccagccg
gttcttgcggctttcagagttaatggtgaacccaagttcagcatgatgccgaggagtcca
ggtccaggatctcgggggccaactagcccaacatctcctcttcacgcacgtttgggaggc
atgagtttggagtctcccactgggaagctagatgatgggaagagtgtgtgtcatccactt
cctctccctccaggttctcctactagcccttcttccttgaccaacaatagaactagtagt
ggagtcattgaaagcatagcttgtgccctgtcaaagtggaagaagggaaggcttctggga
aggggaacttttggtcacgtttatgtcggatttaacagtgaaagcgggcaaatgtgtgca
attaaagaagtcaggcttatcactgatgatcagtcacttaaagaatgtctgaagcaactg
aaccaggaaataaacttactaagtcagctctcccatccaaacattgttcgatatcatggg
agtgaattgggtgaagaggcactttcggtttatttggagtatgtctctggtggctcaatt
cataaattgcttcaagaatatggtgcctttaaagaacctgtcattcaaaattacaccaga
cagatattatctggtcttgcctacttacatggcagaaatacggttcatagggacattaaa
ggtgcaaacatattagtggaccctaatggtgaaatcaagttggcagacttcggcatggct
aaacatattacaaattgtgcttcgatgctgtcattcaaaggaagtccttactggatggcc
cctgaggttgtcatgaatacaaatggctatagtcttgcagtggatatatggagcttggga
tgtactattcttgaaatggcaacatcaaaacctccatggagccagtatgaaggggtggct
gcgatatttaagattgggaacagcaaagatatgccagacattcctgattatctttcccat
gatgcgaaaaactttgtgaggctgtgcttgcaacggaacccatcagagcgtcctactgct
tctcaactgctagaccaccctttcattagagagcaaatgacaacaaggagttcaaacata
aagctaaccaaggatgccttcccatacgcctttgatggaagcaggactccgccaatacta
gagctgcattcaaacagaacgagcatcaccttgggtgatgcagatcacataatgaaaccc
tcagtaacaacttcaagggctatacgcagccccagagacaatgcgaggatgattacatct
ttgccggtatctccttgttcaagccctttacgacaatatggaccagcacacaagagctgt
tttctttctcctcctcacccaacttatgccatgatgggacagaataattacaatttgaat
gagtactcatcatatacaacaagaccaaacacatcatacactctcgaaccttggcgggaa
tcacctctacttagaccccaaacaccaggtggatcaccgagaacgagacccatttga

DBGET integrated database retrieval system