KEGG   Fragaria vesca (woodland strawberry): 101314790Help
Entry
101314790         CDS       T02666                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101314790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fve03036]
    101314790
Enzymes [BR:fve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101314790
Chromosome and associated proteins [BR:fve03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101314790
   Polycomb group proteins
    PRC2-EZH2 complex
     101314790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 101314790
NCBI-ProteinID: XP_011463980
LinkDB All DBs
Position
LG1
AA seq 907 aa AA seqDB search
MASKASPSASANRSEPHQDPPMTGTEETAMTRDQKEISLIIDSLQKQVISNRGVSIKKRM
EENRQKLAAVTNNFYNLSLERRNNSLLNPGKSVDLLTKRQQDAFKLQNGDESNGSNDSSQ
EDGRGSTAVLLESNVAVKNAVRPIKLPEVKRLPPYTTWVFLDRNQRMTEDQSILGRRRIY
YDQNGGEALICSDSEEEAIDEEEEKREFVESEDYILRMTIKEAGVSDPVLESLAHYFSRS
PTEVKARYEALIKEEESMGISKNTDDEDLSKNDNSFLDKDLDAALDSFDNLFCRRCLVFD
CRLHGCSQDLVFPAEKHAPRSPPDDENLPCGPNCYRSVRKSEGTVSSPMNDYLEEKGSKR
SSGLSRKKGKSFQSESASSNAKNISESSDSENETRQDDTCSHDPISSKTKVAGKIGTPKR
NSKRVAERVLVCMQKRQKKTMASDSDSIVDGGLCASDTKLRSNSCKDNEDTSSSSQKNLK
SSTSGRSRRESPLKDSNKVVQGEVVDGSLNEMITDPPATSSDDNLRKEEHVDENIYKQEC
SDDKTWKTIETSLFEKGIEIFGKNSCLIARNLLNGMKTCWEVFQYMNYSDSKVSCQAGDA
ANSLVEGYSKGNNEARRRSKFLRRKGRVRRLKYTWKSAAYHSIRKRITDKKDQPCRQYNP
CTCQTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDP
DVCRNCWVSCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVSK
HEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPDPN
CYAKVIMVAGDHRVGIFAKERIASGEELFYDYRYEPDRAPAWARKPEASGSKRDDTAPSS
GRAKKLA
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcttcgccttccgcctctgctaacagatcggagcctcaccaggatcct
ccgatgacgggaacagaagaaactgctatgaccagggaccaaaaggagatttcattgatt
atagattctctgcagaagcaagttatttctaaccgcggtgtttctataaagaaaagaatg
gaagaaaacaggcagaaattggctgctgtcactaacaatttttataacttgtcattggaa
agaagaaacaatagcttattaaatcctggtaaaagtgttgacctattgacaaagaggcaa
caagatgcatttaagctgcaaaatggtgatgaaagtaatgggagcaatgatagctctcaa
gaagatgggcgtggttccacagcagttcttctggaatctaatgttgctgtcaagaatgct
gttcgccctatcaagcttccggaagttaaaagactacctccttatactacatgggtattt
ttggacagaaatcaaagaatgactgaggatcagtcgattttgggtcgaagaagaatttat
tatgatcaaaatggaggtgaagctcttatatgtagtgatagtgaggaggaagcaattgat
gaagaagaggaaaagagggagtttgttgaatctgaagactatatacttcgcatgactata
aaagaagctggtgtctccgatcctgtgctggagtcattggcacattatttctccagaagc
cctactgaagtcaaggcaagatatgaagctcttataaaagaagaggagtccatggggatt
tctaagaatacggatgacgaagacctttcaaaaaatgacaattcttttcttgataaagat
ctggatgcagcccttgattcatttgataacctattttgtcggcgatgccttgtatttgat
tgcagattgcatggatgttcacaggatcttgtctttcctgccgagaaacacgctcctcgg
agtccaccagatgatgaaaatttgccatgtggtccaaattgttatagatcggtacggaag
tctgaaggtacagtaagctctccgatgaatgactatctggaagagaaaggtagcaagaga
tcttctggtttatctagaaagaagggaaagtcctttcaaagtgaaagtgcttcatcaaat
gcaaaaaacatatcagaaagcagtgattcggagaatgaaaccaggcaggatgatacttgt
agccatgatccaatatcctcaaagactaaggtagcagggaaaattggaacccctaagagg
aacagcaagagagttgcagagcgtgttctggtttgtatgcagaagaggcagaagaaaaca
atggcttctgattctgattcaatagttgatggtggtctttgtgcaagtgatacaaagctt
agatctaattcatgcaaagataatgaagacactagttcgtcttcgcaaaagaatctaaaa
tcttctactagtggaaggtctaggagggaatcacctttgaaggacagtaacaaagtagtt
cagggtgaagttgttgatggctcattaaatgagatgatcactgatccacctgccactagt
agtgatgacaatttgagaaaagaagagcatgtagatgaaaacatatacaagcaagaatgc
agtgatgacaaaacttggaaaactattgaaacaagtcttttcgagaaaggcatagagata
tttggcaagaacagctgtttaatagcaaggaacttgttaaatggcatgaaaacttgttgg
gaagtctttcagtatatgaattactcggacagtaaggtttcctgccaagcaggtgatgct
gcaaactcccttgttgaagggtattccaagggtaataatgaagcaagaagaagatcaaaa
tttttacgtaggaagggtagagttcgtcgcttgaagtacacttggaagtctgctgcttac
cattcgatcaggaaacgaattactgataaaaaagatcaaccatgcaggcagtataatcca
tgtacttgccaaacagcttgtggaaagcagtgtagttgtcttctaaatgggacatgttgt
gagaagtactgtgggtgtcctaagagttgcaagaatagatttagaggctgtcattgtgct
aaaagtcaatgccgaagtcgtcaatgcccatgctttgctgcagatagggaatgtgatcca
gatgtttgtaggaattgctgggtcagttgtggtgatggtagtcttggggttccgaaccaa
agaggtgataattatgagtgtagaaatatgaagcttcttctgaaacaacaacaaagggtc
ttacttggaagatctgatgtatctggctggggtgctttcttaaagaatagtgtcagcaag
catgaatatcttggtgagtatactggggagttgatctcacatcgtgaagcagataagcgt
ggaaaaatatacgaccgtgaaaattcatcatttctcttcaatctgaatgatcagtttgtt
cttgatgcctatcggaagggtgataaattgaagtttgccaaccactctccagatccaaat
tgctatgcaaaggtcattatggttgctggagatcacagggtgggtatatttgccaaggaa
cgaattgcttcgggagaggaacttttctatgattaccgttatgagccagatagagctcct
gcttgggctcggaagcctgaggcatccgggtcaaaaagagacgacacagccccgtcaagt
ggtcgcgcaaagaagcttgcttaa

DBGET integrated database retrieval system