KEGG   Fragaria vesca (woodland strawberry): 101315253Help
Entry
101315253         CDS       T02666                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00630  Glyoxylate and dicarboxylate metabolism
fve00710  Carbon fixation in photosynthetic organisms
fve01100  Metabolic pathways
fve01200  Carbon metabolism
Module
fve_M00165  Reductive pentose phosphate cycle (Calvin cycle)
fve_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
fve_M00532  Photorespiration
fve_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:fve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101315253
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101315253
Enzymes [BR:fve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101315253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 101315253
NCBI-ProteinID: XP_004303137
LinkDB All DBs
Position
LG6
AA seq 182 aa AA seqDB search
MASSMFSSSAAAVATAASPAQASMVAPFTGLKSASAFPITRKTNSDITSLPSNGGRVQCM
QVWPPVGLKKFETLSYLPPLTSESLAKEVDFLLRNKWVPCLEFELEKGFVYRENHKSPGY
YDGRYWTMWKLPMFGCTDASQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKPA
GY
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccatgttctcatcatcggctgccgcagtcgccaccgccgcctccccggca
caagccagcatggttgcgccattcactggcctcaagtctgcctcagctttccccatcacc
agaaagaccaacagtgatattacctcactcccaagcaatggcggaagagtgcaatgcatg
caggtgtggcctccagttggtttgaagaagttcgagacgctgtcctaccttccaccgctt
acttccgagtccttggccaaggaagttgatttccttctccgcaacaaatgggttccctgc
ttggaatttgagttggagaaaggattcgtgtaccgtgagaaccacaagtcaccgggatac
tacgacggccgctactggaccatgtggaagttgcccatgttcggatgcaccgacgcttcc
caagtgttgaaggagctcgaggaggccaagaaggcttatccaaatgctttcatccgtatc
atcggattcgacaatgtccgtcaagttcagtgcatcagtttcatcgcctacaagcctgca
ggctactaa

DBGET integrated database retrieval system