KEGG   Fusarium verticillioides: FVEG_00957Help
Entry
FVEG_00957        CDS       T04869                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00010  Glycolysis / Gluconeogenesis
fvr00051  Fructose and mannose metabolism
fvr00052  Galactose metabolism
fvr00500  Starch and sucrose metabolism
fvr00520  Amino sugar and nucleotide sugar metabolism
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
fvr01130  Biosynthesis of antibiotics
fvr01200  Carbon metabolism
Module
fvr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fvr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FVEG_00957
   00051 Fructose and mannose metabolism
    FVEG_00957
   00052 Galactose metabolism
    FVEG_00957
   00500 Starch and sucrose metabolism
    FVEG_00957
   00520 Amino sugar and nucleotide sugar metabolism
    FVEG_00957
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FVEG_00957
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fvr04131]
    FVEG_00957
Enzymes [BR:fvr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     FVEG_00957
Membrane trafficking [BR:fvr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    FVEG_00957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 30059291
NCBI-ProteinID: XP_018743470
UniProt: W7LPC3
LinkDB All DBs
Position
1
AA seq 492 aa AA seqDB search
MVGLGPRRPPSRKGSMADVPKDLADEIHKLEKLFTVEPAKLKEITDHFVSELAKGLSVEG
GSIPMNPTWVMSYPDGYETGTYLALDMGGTNLRVCQITLTEEKSEFDILQSKYRMPEELK
SGTSEELWEYIAECLYQFLETHHGDCSKLEKIPLGFTFSYPATQNYIDEGILQRWTKGFD
IDGVEGKNIVPMFEEALKARGVPIKLAAIINDTTGTLIASAYTDTAMKIGCIFGTGCNAA
YMEDCGSIPKIADLNLPADLPMAINCEWGAFDNEHKVLPRTAYDVTIDKESPRPGQQAFE
KMIAGLYLGEIFRLILVDLHDNKAIHIFENQDISLLRKPYSLDASFLSAIEEDPWENLTE
TYDLFVKKLNLKPTRPELELVRRTAELIGTRAARLSACGVAAICKKKGYESCHVGADGSV
FNKYPYFKERGAQALREILDWPEKTDKKAEDPIEVLTAEDGSGVGAALIAALTLKRINEG
NMAGILHPENFK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtcggtcttggtcctcgacgtcctccctcccgaaagggatcaatggccgatgtccct
aaggatctcgccgatgagattcacaagctcgagaagctcttcacggtagagcccgccaag
ctcaaggagattaccgaccattttgtctccgaattggccaaaggcctcagtgttgagggg
ggtagcatccctatgaaccctacctgggtcatgtcataccccgatggctatgaaaccgga
acttacctggccctggatatgggcggaacaaacctgcgagtctgccaaatcactctgact
gaagagaaatccgagttcgatatcctccagtccaagtaccgcatgcccgaggagctcaag
tctggtacatctgaggagctttgggaatacattgccgagtgtctttaccagttcctcgag
actcaccacggggactgtagcaagctggagaaaattcctctgggtttcacattctcatat
cctgccacccagaactacatcgatgagggtatcctgcagcgatggaccaagggctttgac
attgatggtgtggagggcaagaacatcgtgcccatgttcgaggaggccctgaaggctcgc
ggcgtccccatcaagcttgcggctatcattaatgatactactggcacattgatcgcttcc
gcttataccgataccgctatgaagatcggctgcatctttggtactggctgcaatgctgct
tacatggaagactgtggctccattcctaagattgccgacctgaatttgcctgccgatctg
cccatggctatcaactgcgagtggggagcttttgataacgagcataaagtccttccccga
actgcctacgatgtgactatcgataaggagtctcctcgcccaggacaacaggccttcgaa
aagatgattgctggtctctacctaggcgagattttccggctcatcctcgttgaccttcac
gataacaaagccatccatatctttgagaaccaagatatctctctgctacgcaaaccttac
tcccttgatgcttccttcctgtctgctattgaagaagacccctgggagaaccttactgag
acgtatgatctcttcgtcaagaagctgaacttgaagcccacacgccccgaactggagctc
gttcgaaggaccgccgagctcatcggcacacgtgctgctcgcctttcggcttgtggtgtc
gctgctatctgcaagaagaagggatacgaatcttgccacgtcggtgctgatggctctgtg
ttcaacaagtacccctacttcaaggagcgaggagctcaggccctgcgagagattctcgac
tggcctgagaagaccgacaagaaggccgaggaccctattgaggttcttactgctgaggat
ggcagtggtgtcggcgccgccctgattgccgccctgaccctaaagcgaatcaatgagggc
aacatggcgggtatccttcatcccgagaacttcaaataa

DBGET integrated database retrieval system