KEGG   Fusarium verticillioides: FVEG_03078Help
Entry
FVEG_03078        CDS       T04869                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP], mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00020  Citrate cycle (TCA cycle)
fvr00480  Glutathione metabolism
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
fvr01130  Biosynthesis of antibiotics
fvr01200  Carbon metabolism
fvr01210  2-Oxocarboxylic acid metabolism
fvr01230  Biosynthesis of amino acids
fvr04146  Peroxisome
Module
fvr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fvr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FVEG_03078
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FVEG_03078
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    FVEG_03078
Enzymes [BR:fvr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     FVEG_03078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 30061244
NCBI-ProteinID: XP_018747004
UniProt: W7LZF4
LinkDB All DBs
Position
5
AA seq 462 aa AA seqDB search
MPAAVFASSVQRSLLSSSLRRVAVSSSAIRPVRASFGAIQTISPFAVRTMASHQKIKVKN
PVVELDGDEMTRIIWQVIKDKLILPYLDIDLKYYDLGLEYRDETNDQVTIDAAEAIKKYS
VGVKCATITPDEARVEEFKLKQMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPGWKKPI
IIGRHAFGDQYRAKDAVLPGPGKLSMVYTPEGGQPQEIEVFQFKNGGGVAQTQYNTDESI
TGFAHASFKLALDKELPLYMSTKNTILKKYDGRFKDIFQEIYESTYKKDFEAKKIWYEHR
LIDDMVAQMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAH
GTVTRHYREHQKGNETSTNPIASIFAWTRGLVQRGKLDDTPEVVAFAESLEQACIDTVDI
DGIMTKDLALATGKSERKDYVTTNEYMDAVERRLKRTLKEKL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgctgtcttcgcctcttccgttcagcgatctcttctctcgtcttcgctgcgc
cgtgtcgctgttagttcatccgccatccgccctgtccgagcttccttcggtgccatccaa
accatctctcccttcgccgtccgcacaatggcttcccaccagaagatcaaggtcaagaac
cctgtcgtcgagctcgacggcgatgagatgacccgcatcatctggcaggtcatcaaggat
aagctcatccttccttacctcgacatcgacctcaagtactatgatcttggtcttgagtac
cgtgatgagaccaacgatcaggtcaccatcgatgccgccgaggctatcaagaagtactcc
gtcggtgtcaagtgtgctaccatcacccccgatgaggctcgtgtcgaggagttcaagctg
aagcagatgtggctttcccccaacggaaccatccgaaatgcccttggtggtaccgtcttc
cgtgagcccattgtcatcccccgcattccccgtcttgttcctggatggaagaagcccatc
atcattggccgtcacgcctttggtgaccagtaccgcgccaaggatgctgtcctgcccggc
cctggtaagctctccatggtttacacccccgagggtggccagcctcaagagattgaggtc
ttccagttcaagaacggcggtggtgtcgctcagacccagtacaacaccgacgagtccatc
actggtttcgctcacgcttccttcaagctggctcttgacaaggagctccctctctacatg
agcaccaagaacaccatcctcaagaagtacgatggtcgattcaaggatatcttccaggag
atctacgagtccacctacaagaaggacttcgaggccaagaagatctggtacgagcaccgt
ctcattgatgacatggtcgcccagatgatcaagagctctggcggttacatcatggccctc
aagaactacgatggtgatgtccagtccgacattgtcgctcagggtttcggctctctcggt
ctcatgacctccgttctcatcacccctgatggcaagactttcgagtctgaggctgcccac
ggcactgtcactcgccactaccgtgagcaccagaagggcaacgagacctccaccaacccc
attgcctccatcttcgcctggacccgtggtctcgtccagcgtggcaagctcgatgacacc
cccgaggttgttgcctttgccgagagcctcgagcaggcttgcattgacactgtcgatatt
gacggtatcatgaccaaggatcttgcccttgccactggcaagtctgagcgcaaggactat
gtcaccaccaacgagtacatggatgccgttgagcgccgcctcaagcgaaccctcaaggag
aagctgtaa

DBGET integrated database retrieval system