KEGG   Fusarium verticillioides: FVEG_04947Help
Entry
FVEG_04947        CDS       T04869                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00500  Starch and sucrose metabolism
fvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FVEG_04947
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     FVEG_04947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 30062974
NCBI-ProteinID: XP_018749701
UniProt: W7M7D5
LinkDB All DBs
Position
4
AA seq 679 aa AA seqDB search
MPALYKTLTMDPVDVGDSVSSVSINSTASLIQLIMYFVSSAFLLGSFVLQNVLGRPTFDE
RSLLQERQSSVDSFIKSESSIAIEQLLCNIGSDGCNSKNVATGIVIASPDTQDPDYFYTW
TRDAALVFKYVVDRFINQYDAGLQRKIQEYIASQAKLQGVSNPSGSLSDGSGLGEAKFNV
DMSAFTGGWGRPQRDGPALRATAMITYANWLIANGYTSTANDIVWPVVRNDLNYVAQYWN
QTGFDLWEEVKGSSFFTTGSQYRALIEGAALAKKLGKSGDNYSNIAPQALCFLQTYWISS
GKYVDSNINVNDGRTGKDANSILSSIHNFDPALNCDPATFQPCSDKALANHKAVTDSFRS
WNINKGISQGSAVAVGRYVEDVYYNGNPWYLATLAAAEQLYDAIYVWKQQGSITVSDVSL
SFFKDLVSSVSTGTYASDSATFKSITDAVSKYADGYVAIVAKYVGTDGHLAEQFDKNDGH
PLSATDLTWSYAAFLSAADRRAGVIPPSWAGSVAAVPNQCGTNTVAGSYSSATATSFPAS
QTPKGGVPTPTGTQTSTSTSTSTSSSSTGTSCPTATSVAVTFQEVVTTNFGDTIKIVGNI
AALGNWDTSKAVALSASDYTASNPVWKATISLTAGQSIQYKYINVKKDGSLTWEKDPNRT
YAVPKTCATTATKSDKWQS
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgccggctctctataaaaccttgacgatggacccggtagatgttggtgattcagtctca
tcagtctcgatcaactctacagcctctctgatacagctcatcatgtactttgtgtcttct
gcctttcttctcggctcattcgttcttcagaacgtcttgggccgaccaaccttcgatgag
aggagtctcttacaagagagacagtcttcggtcgactcctttatcaagtctgagagctca
attgctattgagcaactcctctgcaatatcggttccgatggctgcaactccaagaacgta
gccactggtattgtcattgcttctccagacacacaggatcctgactacttttacacctgg
actcgagatgctgctctagtcttcaagtacgtcgttgataggttcatcaaccagtatgat
gctggcttgcagaggaagatccaggagtacatcgcctcccaagccaagctccagggtgtt
tccaacccttctgggtcgctttcggatggctcaggtctgggagaggccaagttcaacgtc
gacatgagtgccttcactggtggttggggtcgacctcagcgagatggtccagctctgcgt
gcgactgctatgatcacctatgccaactggctgattgccaacggctacacctccacagcc
aatgacattgtgtggcctgttgttcgcaacgaccttaactatgtggctcagtattggaat
caaaccggatttgacttgtgggaggaggtcaagggtagttcgttcttcacaactggttcc
cagtatcgagctctcattgaaggcgccgctctggccaagaagctcggcaagtcgggagac
aactactccaacatcgctcctcaggctctctgcttcttgcagacttactggatctcttct
ggcaaatacgtcgactctaacatcaatgtcaatgacggccgcactggcaaggacgccaac
agtatcctgtcgtccatacacaatttcgaccctgctctgaactgtgatcccgccaccttc
cagccatgcagtgacaaggccctcgccaaccacaaggcggttactgactctttccgctca
tggaacatcaacaagggtatctctcaaggctcagctgtcgccgttggacgatacgtcgaa
gatgtctactacaatggcaacccctggtacctcgctacgcttgccgcggcagagcagctc
tacgatgccatttatgtctggaagcagcagggatccatcactgtgtcggacgtctctctt
tcgttcttcaaggacctcgtctcttcggtctctaccggaacatacgccagtgactctgcc
accttcaagagcatcactgacgccgtctccaagtatgctgatgggtatgttgccatcgtt
gcaaagtatgtcggcacagatggccacctcgcagagcagtttgacaagaacgacggccat
cctctttctgccacagacttgacttggtcatatgccgcattcctctcagctgctgatcgt
cgagctggtgttattcctccctcttgggctggaagcgtggctgctgtccccaaccaatgc
ggtaccaatactgttgctggatcctactcatcggctactgcaacttcgttcccagcatcg
caaacacccaagggtggtgtgcccactccaactggcacccagacttccacttccacttcc
acttccacttccagctcgtccactggtaccagttgccctactgcaacctctgtggctgtc
actttccaagaagttgtcaccaccaactttggtgataccatcaagatcgttggcaacatc
gctgctctcggtaactgggacacatcaaaggctgttgccctgagcgcctccgactatacc
gcctcgaaccctgtgtggaaggccaccatttccctaactgcaggacagtccatccagtat
aagtacatcaatgttaagaaggacggctctcttacctgggagaaggaccccaaccgcacc
tacgctgttcctaagacatgtgccacaacggctaccaagtctgacaagtggcagtcttga

DBGET integrated database retrieval system