KEGG   Fusarium verticillioides: FVEG_06850Help
Entry
FVEG_06850        CDS       T04869                                 

Definition
(RefSeq) histone deacetylase HOS3
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
fvr  Fusarium verticillioides
Brite
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     FVEG_06850
Chromosome and associated proteins [BR:fvr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     FVEG_06850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 30064713
NCBI-ProteinID: XP_018752504
UniProt: W7M412
LinkDB All DBs
Position
7
AA seq 1167 aa AA seqDB search
MASPNRPSLSVRRQSSARNLRQPEHDDLTQSLNQLSISTSPGRAPSRLSSEPASPFRSSG
RRTSQSPAPNARVLSRSPSRTREASRDTPTLLRKASMNSLRSSNGIGPGSTPSRRSSVVH
HISPTQAKSPLSSTPPVLEKPRPTAISIAHDNLSDELQAHHGATSTRPTQMIVVLNDAVY
GHRFSRPRTSRAALSTIVERPERIKAAVLGISAAYVRLGGRHSEGEYPLHPKREAEDIHG
IPFRIQKTERRLSLLSPAVVNVHGTKWMEELKMMCDAAESKLAMGGKELQRPQMNRGAEK
ADKFHEGDLYLCSESLDAMEGALGAVCEAIDTVFGPGPQRAFVGVRPPGHHCSASYPSGF
CWVNNVHVGIMHAALNHGLTHAAIIDFDLHHGDGSQAITWQHNSRGNNAAKNAAAWKKSS
IGYFSLHDINSYPCEMGDEEKVRSASICIDNAHGQTVWNVHLEPWKSEEEFWKLYETRYI
VLLDKVRNYLKNQAERLREFNLPPKAAIFFSAGFDASEWESAGMQRHKVNVPTEFYARIA
QDVVKLAAEEGLHVDGRVISVLEGGYSDRALCSGILSHLSGLAGDQTYAQEPDNVGRLGV
EMGQKIGSLSGEMSYSFEQKPSLDSVHAYDPSWWSPSHLDELEALMEVPDGPAKKPQSAT
LPTYFSPTQASTAKVSDPIKMRRSLSNLGASITRPPSPPPPEVPWAIAVHELSKLLIPSS
RQTDSCKPEELNAEASKARRDRQSIIMGIDPNPLATSSSRPTSRMSLRERRAKAAPTPEP
TSEKTTTSRRRTMGAAPISSDKAVARGVSSRTNSGEPAVRRTSRRLSEIPASLTTRDVSP
GEADRPEVVEHARTVPNSPMATKSVANTNPPVKKARTSTAPRKEPAPRAPRGTKKATTTA
GPSRPATATQKAKSPVKASKKDGASSAGGDDIDSLTSGMKKIRINLITQSQKEAKERARL
EAEKAKGKESSITYKPATTSSSTEHPSSVTDHSQTPVSASVEAHDISPTQPAPGNARIPS
PPTTASSRRIMSPSQEQYAFESTAQVTQLMSPPLSSPAIPSVSVHPSTDADDIFVPYQPE
GPAPESVAQSEPLKWLPPNVPTSSEQTPAATPSPAKKSNLFQYTSGGIPFAPRPGQGPSE
LKHAEQGVKPEPKSPKSIEEIPETPQH
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgccaaaccgcccatcgctgtcggttaggcgacagtcttccgcacggaacctc
agacagcccgaacatgacgacttaactcagtccttgaaccaactctccatctccacttcg
cccggcagagctccgtcccgcctctcctccgaaccagcttctccattccgctcatcgggt
cgtcgcacgtcgcagtcgcctgcgccaaatgctcgggttctgtcccgtagcccgtcccgg
actcgtgaagcttctcgggacacacctacactactacgaaaggcgtctatgaactcgctg
cgctcctctaacggtatcgggccaggttcgaccccttcgagacgttccagcgtggtgcat
cacatatcaccaactcaggccaagtcgcctctgtcatctactcctcctgtgctggagaaa
ccccgaccaactgcgatttccattgcacatgacaatctcagtgacgagttgcaggcgcat
catggcgcaacatccactcgcccaacccagatgatcgtagtgctaaacgatgccgtctat
ggacatcgcttctcccgaccccgaacttctcgtgccgctctcagtactatcgtcgaacgc
ccggaacgaataaaggcagctgtgttgggtatatctgcagcgtatgtccgcttgggtgga
agacattctgagggtgaatatccgcttcatcctaaaagagaggctgaggatattcatggc
atcccattccggatacaaaagacagaacgtagactttctcttttgtcaccagctgttgta
aatgtgcatgggacaaaatggatggaagaactcaaaatgatgtgcgatgcagccgaatcg
aagcttgcaatggggggcaaggagttgcagagaccacagatgaacagaggggctgagaaa
gctgacaagttccacgaaggtgatctctacctttgctcagagtctttggacgccatggag
ggtgctctgggggctgtctgcgaagccattgacactgtttttggtcccggacctcagcgg
gcctttgttggcgtgcgacctcccggccaccattgttccgcctcctatccttcaggcttc
tgttgggtcaacaatgttcatgttggtatcatgcatgcagctctcaaccatgggctcacg
catgctgcgatcattgactttgatcttcatcatggtgatggttctcaagccattacatgg
cagcacaattctcgaggaaacaatgctgctaagaatgcggcagcatggaagaagtcttcg
attggctacttcagtttgcacgacatcaactcgtatccgtgtgaaatgggcgatgaagaa
aaggttagaagcgccagtatctgtatcgacaacgcacacggacaaactgtttggaatgtc
catctggagccttggaaatctgaggaggagttctggaaactctacgagaccaggtatatt
gtgctcttggacaaggtaagaaactatctcaagaaccaggcggagcgattgagagaattc
aacttgcctccgaaggctgccatcttcttctctgctggctttgatgccagtgaatgggag
agcgcaggaatgcagcgtcacaaggtcaacgtgccaacagaattctatgcccgtattgcc
caggatgtcgtcaaattggccgctgaagaagggcttcacgttgatggtcgagttatcagc
gtgctagaaggcggctatagcgatcgagctttgtgctctggtattctaagccatctcagt
gggctcgctggagatcaaacctacgctcaagagccagacaatgttggccgtcttggtgtc
gaaatgggacagaagattggatccctttcaggggaaatgtcatacagtttcgagcaaaag
ccgtcattggactctgttcatgcttacgacccatcgtggtggtcgccatcccatttggat
gagctcgaggctttgatggaggttccagatggtccagccaagaagccgcagagcgctact
ctcccaacctacttctcaccaacacaggcatccacggctaaggtctcagatcccatcaag
atgcgacgtagtttgtccaacttgggtgcatctataaccaggcctccatcaccacctccg
ccagaagttccttgggccattgcagtccatgagctcagcaagctcctgattccctctagt
cgtcaaaccgatagctgcaagcctgaggaactgaacgcagaggcaagcaaggcgagacga
gatcgccaatcaataatcatgggcattgacccaaaccctcttgctacttcttcttcgcgc
ccaacctcgcgcatgtctctgcgtgagaggagagccaaggcagcacctactcccgagcca
acctctgaaaagacaaccacaagccgcagaagaacaatgggcgctgcccccatctcttca
gacaaggcggttgcgcgcggtgtctcctcgaggacaaacagtggtgagccggcagtgagg
aggaccagtcgtcgtcttagtgagatcccggcatccctcacaacaagagatgtatcacca
ggtgaagcagatcggcctgaggtagtagaacacgctcgtacagtccccaactcgcccatg
gctacgaaatcagttgccaacaccaatcctccggtcaagaaggcaagaacttctactgcc
cctcgcaaggagcctgcgccaagagcgcctcggggtaccaagaaagctactactaccgct
ggcccttcgcgacctgccacagctacacagaaagccaagtcgccagtcaaggcttcgaag
aaggacggtgcatctagcgcgggtggcgatgatattgacagcctcacctctggtatgaag
aagattcgtatcaacctgatcactcagtctcagaaggaagccaaagagcgagctcgcctt
gaagctgagaaagccaagggcaaagaatcttctatcacatacaagcctgccacgacatct
tccagtactgagcatccatcatcagtcactgaccatagccagacccctgtcagtgcttcc
gtcgaggcgcatgatatctctcctactcaacctgcaccgggtaatgcccgcatcccttca
ccacctaccactgcctcttcgagaagaatcatgtctccctcacaagaacaatacgctttc
gaatccactgcgcaagtcactcagctgatgtctcctcctctgagttctcctgccatcccc
tctgtttccgtacaccctagcacggatgcagatgatatctttgttccctaccaacccgaa
ggccctgcgcctgagtccgttgctcagagcgagcctttgaagtggcttccacctaatgta
ccaacttcatctgagcaaacgcctgccgcgacacctagcccggccaagaagagtaatctt
ttccaatacacttccggtggtattccatttgcccctcgcccgggacagggaccaagtgag
ctcaagcacgcggagcagggtgttaagccagagccgaagtcgccgaagtctatcgaggag
attcccgagacgcctcagcattaa

DBGET integrated database retrieval system