KEGG   Fusarium verticillioides: FVEG_07075Help
Entry
FVEG_07075        CDS       T04869                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
fvr  Fusarium verticillioides
Pathway
fvr03030  DNA replication
fvr03410  Base excision repair
fvr03420  Nucleotide excision repair
fvr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:fvr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FVEG_07075
   03410 Base excision repair
    FVEG_07075
   03420 Nucleotide excision repair
    FVEG_07075
   03430 Mismatch repair
    FVEG_07075
Enzymes [BR:fvr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FVEG_07075
    6.5.1.6  DNA ligase (ATP or NAD+)
     FVEG_07075
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     FVEG_07075
DNA replication proteins [BR:fvr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    FVEG_07075
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     FVEG_07075
DNA repair and recombination proteins [BR:fvr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     FVEG_07075
   NER (nucleotide excision repair)
    Other NER factors
     FVEG_07075
   MMR (mismatch exicision repair)
    Other MMR factors
     FVEG_07075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase MctB
Motif
Other DBs
NCBI-GeneID: 30064915
NCBI-ProteinID: XP_018752887
UniProt: W7M6S6
LinkDB All DBs
Position
7
AA seq 916 aa AA seqDB search
MLLSVRSTRGLTIAPLFLQNTSRLSSRPVNRYSLCLFRLFSTTIPGIMAPKQATLGKFFG
AKGAPPQQTKLSFSSKPKKEEVKDEEEADMKVKSGSDSEKETKKRARSEDKPKPEPTPIQ
KEEADDESDGPVTKRARRSRRRIEEEDDDEMGEETVKKDTHASPKKSNVASTSPKVKSPK
RSKPTPKAKAAKEPTPDENDDSAKEEASTASASEAELDDEADVEDKPEVAAKAREKVQTK
FKSKMKDPYPDWKPGTPVPYAALCTTFSLVEMTTKRLIIMEHCSLFLRQVMRLTPEDLLP
TVLLMINKLAPDYAGIELGIGESLIMKAIGETTGRSLQVIKADQKEIGDLGLVAVKSRST
QRTMFKPKALTIRGVHQGLMNIATVTGNGAQGRKVDGIKKLLAAADANSTGKVDITKDKG
GPSEAKFIIRFLEGKLRLGLAERTVLVSLAQAIVAHEADAKGKVPSTSDLEKGESILKTV
YSELPSYDVIIPAMLEHGIMKLRENCKLRPGVPLKPMLAKPTKAITEVLDRFEGQTFTCE
YKYDGERAQIHYVAKDAPQELSEASQGAAKEAAAGVASIFSRNSEDLSRKYPDILAKLHT
WVKPDTKSFVLDCETVAWDVDEKKVLPFQQLMTRKKKDVKVEDVKVKVCVFAFDLLYLNG
EAVVEKALRERRELLETAFNPVEGEFSFATHMNGQELDEIQVFLDESVKASCEGLMVKML
DGTESGYEPSKRSRNWLKIKKDYLSGVGDSLDLVVLGAYYGKGKRTSVYGAFLLACYNPN
SETYETVCNIGTGFSEQVLEDLHTQFSEITIDRPKPFYSHSSGGQHQPDVWFEPRYVWEV
KTADLTLSPRYKAGAKEGVDPSGNKGISLRFPRFIRVRDDKKADAATTSRQVAEMYRKQE
SVTKNKGPSVDDDFEY
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgctactcagtgtcaggtcaactcgcgggctcacaattgcccctctctttttacaaaac
acttccagattgtcatcacgacctgtaaaccgttactctttgtgtttgtttcgtttgttt
tcaacaacaattccaggcatcatggccccaaaacaggcgacactcgggaagttctttggg
gcaaaaggtgcgcctcctcaacagacaaagctttccttcagcagcaaacccaaaaaagaa
gaagtgaaggacgaagaggaggctgacatgaaggtcaaatctggctccgattctgagaaa
gaaacaaagaagcgagcaaggtcagaagacaagcccaaacccgagcctacgcccattcag
aaagaggaagccgatgacgagagcgatggacctgtcaccaagcgagcacgaagaagtcga
aggcgaattgaggaagaagatgacgatgagatgggtgaagaaaccgtgaagaaggacaca
catgcatcccccaagaagtcaaatgtcgcaagcacatccccaaaagtcaagtcgcccaag
aggtcaaagccaacccccaaagccaaggcggccaaagaaccaactcctgacgagaacgac
gattctgccaaagaagaggcttcgacagcttcagcttcggaagccgagcttgacgacgag
gcagatgtcgaggataagcctgaggttgctgccaaggctcgtgagaaggtccagacaaag
ttcaagtccaagatgaaagacccctatcctgactggaagcccggcacccctgttccgtat
gcggccctgtgtacaactttctctcttgtggaaatgaccaccaaacgattaattatcatg
gagcattgttctctgttccttcgccaggtcatgcgcctgacccctgaggatctattacct
acagtcttattaatgatcaacaaattggctcctgactacgctggcatcgagcttggtatc
ggcgagtcgttgatcatgaaggctatcggcgagacgaccgggcgaagtctccaggtgatt
aaggctgatcagaaagaaattggtgatcttggactggtggctgtaaagagtcgatcaact
cagcgcactatgttcaagcccaaggctttgactatcaggggtgtgcatcaaggcctaatg
aacatcgccactgtcactggcaacggtgcccaggggcgcaaggtggatggtatcaagaag
cttcttgctgcagctgatgccaactccaccggtaaagtcgatattactaaggacaaagga
gggcccagtgaagccaaatttatcattcgattcctggaaggaaagttgagacttggtctg
gctgagagaactgtgcttgtttctttggcgcaagctattgttgcccacgaagcagatgcc
aagggtaaggtccctagtacctcggatcttgagaagggtgaatcgattctcaagactgtc
tacagtgaacttccgagctacgacgtgattattcctgcaatgctagaacacgggatcatg
aagcttcgggaaaattgcaagctccgacccggtgtacctttgaagcccatgctggccaag
ccaaccaaggccattactgaagtactcgatcgcttcgagggacaaaccttcacctgtgag
tataagtatgatggcgaaagagcacaaatccattatgtggcaaaggatgcgcctcaagaa
ctaagcgaagcgagtcaaggcgctgccaaggaggctgctgctggtgttgctagcatcttt
tccagaaactccgaagatctctcccgaaagtatcccgatatccttgccaaactccatacc
tgggtcaagccggataccaagagctttgtcctggattgtgagacagtggcctgggatgtt
gatgagaagaaagtgttgcccttccagcaactcatgacacgcaagaagaaggatgtcaag
gttgaggatgtaaaggtcaaggtttgcgtatttgcatttgatttgttgtacctcaatgga
gaggctgttgttgaaaaggcactgcgtgaacgacgtgagcttctcgaaaccgcgtttaat
cctgtagaaggcgagttttccttcgctacgcacatgaacggtcaagaactggatgagatc
caggttttccttgacgaaagtgtcaaggcatcatgcgagggtctgatggtcaaaatgctg
gatggaactgagagtggatatgagcccagtaagcgaagtcgtaactggctcaagatcaag
aaggattacctctccggcgtcggtgattcactggatcttgttgttttgggcgcatactac
ggcaaaggcaagcgtacatctgtttacggcgcattccttctggcctgttacaaccctaac
tcggagacatacgaaactgtttgcaatattggaactggcttctcagagcaggtcttggag
gatctccatacccaattctctgagattaccattgacaggcctaagcctttttactcccac
tcttcgggtggtcaacaccaacctgatgtctggtttgagcctcggtatgtctgggaagtc
aagacagccgatttgaccctcagtccacggtacaaagccggtgctaaggagggtgtcgac
ccgtcaggaaacaagggcatcagtcttcgattccctcgcttcattcgtgtgcgagatgat
aagaaagctgatgctgccacgacaagtcgccaggttgctgaaatgtatcgcaaacaggag
agcgtgacaaagaacaagggtccctctgttgacgatgactttgagtattag

DBGET integrated database retrieval system