KEGG   Fusarium verticillioides: FVEG_07662Help
Entry
FVEG_07662        CDS       T04869                                 

Definition
(RefSeq) hypothetical protein
Organism
fvr  Fusarium verticillioides
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc NAD_binding_7 Shikimate_DH Pyr_redox_2 Lyase_1 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 30065444
NCBI-ProteinID: XP_018753788
UniProt: W7MSU1
LinkDB All DBs
Position
8
AA seq 359 aa AA seqDB search
MSMKAVRFHGQQDVRLEEIPLPSLEPNSVRISPKFCGICGTDVHEYLGGNNLIPKPGTPH
GITGETSPLTLGHEFSGVVEEVGSEVTRLQKGDRVCVQPIIYDNECRSCKRGLVNCCDKN
GFIGLSGWGGGLCETTVVPQDAVKKLPDNVSLEVGALVEPLAVGWHAIKISPYQEGDSAF
VVGGGPIGLAVVQALIGRGCKNIILSEVSSKRREFARKFGAHHVFDPTKDDIVAEVKKLT
DGLGADVGFDAAGSQHAIDAAFDCLKARAVLVNIAVWEKRAQLNMNQIVFRERSYVGCAT
YALGDFEEVIDALSSGKITPEGMITKVIKMDKVVEEGFQTLINDKDNHVKILVDVSAGV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaaagcagtacgtttccacggacagcaagatgttcggctagaggagattccc
ctcccctctctcgagccaaactcggtccgcatctcccctaagttctgcggaatctgcggg
acagatgtgcatgaatatctcggtggcaataacctcattcccaagcctggaaccccgcac
ggcatcaccggggagacatcgcccctcactctgggtcatgagttcagcggcgttgtcgag
gaagtggggagtgaggttacgcgcctccagaagggagatcgcgtttgcgttcagccgatt
atttacgataatgaatgtcgttcatgcaagcgcgggctggtcaattgttgtgacaagaat
gggtttatcgggctgagtggttggggaggcggtctctgtgaaacgacagttgttccgcaa
gatgctgtgaagaagttgcctgataacgtttctcttgaggttggagcgcttgttgaaccg
cttgccgtcggatggcacgcgatcaagatctcgccatatcaagaaggtgattcagcgttt
gtcgttggtggcggaccaattggactcgctgttgtgcaggcgcttattggcagaggatgc
aagaacattattctcagcgaggtcagctccaagcgtcgagagtttgcaaggaaattcggc
gcccatcatgtgttcgaccccaccaaggacgacatcgtggctgaagtcaagaaattgacg
gacggtttgggcgcagacgtcggttttgacgcagctggctctcagcatgccatcgatgca
gctttcgattgtctcaaggctagagcagtactcgtcaacatcgctgtttgggaaaagagg
gctcaattgaacatgaatcagatcgtgtttcgtgaaagatcatacgttggatgcgccacg
tatgctcttggtgattttgaagaggtcattgatgcgctgtcgagtggcaagattacgcct
gaggggatgattacaaaggttatcaagatggataaggttgtggaggaggggttccagacg
cttatcaatgataaggataatcatgttaagattttggttgatgtcagtgctggtgtataa

DBGET integrated database retrieval system