KEGG   Fusarium verticillioides: FVEG_07903Help
Entry
FVEG_07903        CDS       T04869                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00020  Citrate cycle (TCA cycle)
fvr00190  Oxidative phosphorylation
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
fvr01130  Biosynthesis of antibiotics
fvr01200  Carbon metabolism
Module
fvr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fvr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fvr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FVEG_07903
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FVEG_07903
Enzymes [BR:fvr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FVEG_07903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DUF600 HI0933_like
Motif
Other DBs
NCBI-GeneID: 30065671
NCBI-ProteinID: XP_018754112
UniProt: W7MAB3
LinkDB All DBs
Position
3
AA seq 651 aa AA seqDB search
MMASSMAMRRLAVGPAFTRAARFPSSRAFSTTRPVARVITGNGPLRAKEASPFVSNKYAV
IDHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHED
DWRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTDDGKIYQRAFGGQS
KEYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHKTNYFIEYFALDLIMQDGECRGVLAY
NQEDGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHP
TGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGV
GAEKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRY
TGEVLTVDEKGEDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFN
PGDALKPIAADAASDHIEVLDKVRTADGPKSTAEIRLAMQKAMQTDVSVFRTQESLDEGV
RKMTEIDAMYSQVGMKDRSMIWNSDLVETLELRNLLTCAIQTATSAANRKESRGAHARED
FPERDDENWMKHTLSFQKEPHGKVDLAYRKVIANTLDEAECKPVPPFKRVY
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttcttctatggcaatgaggagattggccgtcggccctgctttcacgcgggct
gctaggttcccttcttctcgagctttctccaccactcgccctgttgcccgagttatcact
ggcaatggtcctctgcgagccaaggaggcctctcctttcgtgagcaacaaatacgccgtc
atcgaccacgagtatgatgctctcgtcgttggtgctggtggtgccggtctgcgagctgct
ttcggtctggccgaggctggcttcaacactgcctgtatctccaagctttttcctactcga
tctcacaccgtcgccgcgcagggtggtatcaacgctgccctaggtaacatgcacgaggac
gattggcgatggcacatgtacgataccgtcaagggttccgactggctgggtgaccaggat
gctattcactacatgacccgagaggctcccgcctccattatcgagcttgagaactacggc
tgccccttctcccgaactgacgatggcaagatttaccagcgagctttcggtggtcaatcc
aaggagtacggaaagggtggacaggcttacagatgctgcgctgctgctgaccgaaccggc
cacgcccttcttcacactctctacggacagtccctccgacacaagaccaactacttcatc
gagtacttcgccctcgacctgattatgcaggatggcgagtgccgcggtgtcctcgcctac
aaccaggaggacggcaccctgcaccgattccttgccaaccacaccgttctcgctactggt
ggttacggacgagcctacttctcttgcacatctgcccacacctgtaccggtgacggtatg
gccatggttgcccgtgccggtctccccaaccaggatctcgagttcgtccagttccaccct
accggtatctacggagctggttgcctgatcactgagggttcccgtggtgagggtggttac
ctcctcaactctgagggtgagcgattcatggaacgatatgctcctaccgctaaggatctt
gcctctcgtgatgtcgtctctcgatccatgaccctggagatccgtgagggccgtggtgtt
ggtgctgagaaggatcacatctacctccagctcagccatctccccgctgagatccttgct
gagcgtctgcccggtatctctgagaccgccggtattttcgccggtgttgatgttcgcaaa
cagcccattcccgttcttcctaccgtccactacaacatgggtggtattcctacacgatac
actggtgaggttcttaccgttgacgagaagggtgaggacaaggttgtccctggtctgtac
gcttgtggcgaagctgcttgtgtgtctgtccacggtgccaaccgtctgggtgccaactct
cttctcgatcttgttgtcttcggtcgtgccgtttcgcacaccatccgtgacaagttcaac
cccggtgacgccctgaagcccattgccgctgatgctgcttccgaccacatcgaggtcctc
gacaaggtccgaactgctgatggtcctaagagcaccgctgagatccgacttgccatgcag
aaggccatgcagactgatgtcagcgttttccgaacccaggagagtttggatgagggtgtt
cgcaagatgaccgagatcgatgccatgtacagccaggttggcatgaaggatcgcagcatg
atctggaactctgatctcgttgagactcttgagctccgcaacttgctcacctgcgctatc
caaaccgccacctctgccgccaaccgaaaggagtctcgtggtgctcacgcccgcgaggat
ttccccgagcgagatgacgagaactggatgaagcacactctttctttccagaaggagcct
cacggcaaggtcgacctggcctaccgaaaggtcatcgccaacaccctggacgaggccgag
tgcaagcccgtgccacccttcaagcgtgtgtactaa

DBGET integrated database retrieval system