KEGG   Fusarium verticillioides: FVEG_08157Help
Entry
FVEG_08157        CDS       T04869                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00250  Alanine, aspartate and glutamate metabolism
fvr00410  beta-Alanine metabolism
fvr00430  Taurine and hypotaurine metabolism
fvr00650  Butanoate metabolism
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
Module
fvr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FVEG_08157
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FVEG_08157
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FVEG_08157
   00430 Taurine and hypotaurine metabolism
    FVEG_08157
Enzymes [BR:fvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FVEG_08157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 30065915
NCBI-ProteinID: XP_018754549
UniProt: W7M9T5
LinkDB All DBs
Position
3
AA seq 506 aa AA seqDB search
MTVTNSRNGNPSITTLHRAEEVNDLIDAVKGLIVPYIKAADDAAAERATGNIHPSPAGVK
NNVLVDFQKPQELAQRLKFSLPNSGQGKEGLLEIIQQVLQNSVNTWDQGFLDKLYASTNA
VGVVSDMVLSVLNTNLHVFQVSPALTIVEKTTAKTLAHLFGFTGSRAGGISCQGGSASNL
TSLVVARNTLFPECRASGNGNHDLVVFTSAHGHYSVEKSAMICGLGSNSVWPVPVDEFGC
MRPDALRELAIRARNEGKTPFYVNSTAGTTVMGSYEPFEEISKICKEFGLWMHIDASWGG
PAIFSSKQKHKLNGAHLADSLTVNPHKMMNVPVTCSFLLGPDMNIFNRANRTAAGYLFHT
SDGDDIWDLADLTLQCGRRGDSLKLALAWIYYGAAGFEKQIDHAFEQAEYLASLIKQSDN
FVLVSQDPPPCLQVCFYYSPERNLSHNKEENTLRTKTMVEKMILRGYMVDYAPGPNGSFF
RVVVNCQTLPGTVEGLVKALEEVGRQ
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgaccaacagccgcaatgggaacccctccataaccaccctccatagggctgaa
gaagtaaacgatctcatcgatgctgtgaagggtctcattgtcccttacatcaaggctgcc
gatgacgccgcagcagagcgtgccacagggaatattcaccccagtccagctggtgtcaag
aataatgtcctggtagactttcaaaaaccacaggagcttgctcaacgactcaagttttcc
ttgccaaattcgggtcaaggtaaggaggggctgttggagattatccagcaagtccttcag
aacagtgtcaatacttgggaccagggcttccttgataaactatatgcaagcacgaacgca
gtcggtgtggtgtcagacatggtactttcagtgctaaacaccaatctccatgtgttccaa
gtttctcccgccctcaccatcgttgaaaaaaccacagcaaagaccctggcacacttgttt
ggtttcactggatcaagagcagggggcatctcctgtcagggaggaagcgcctcaaacttg
acgtcccttgtcgttgcccggaatactttgttcccagaatgcagagcttcaggcaatggt
aaccacgatttagtcgtctttacaagtgctcatgggcattactcggttgaaaagagtgcc
atgatatgtggtcttggttcgaacagcgtctggcctgttcctgtggatgagtttggatgc
atgaggccggatgccctgagggagctggccatccgtgccaggaatgaaggcaagacaccc
ttttatgtgaactcgacggctggaaccactgtcatgggctcatatgagccattcgaggag
atttccaagatttgcaaggagtttggcctctggatgcatatcgatgcaagctggggaggc
cctgctatcttctcgtcgaaacaaaagcataagctcaatggcgcccatctagccgattca
ttgacagtgaaccctcataagatgatgaacgttcctgtcacatgctcattcctcctcgga
ccagatatgaacattttcaacagggccaaccgcaccgccgcaggctatttgttccatacc
agcgatggcgatgatatctgggatcttgcagatctaaccctgcagtgcggtcgccgcggt
gacagtcttaagcttgctttggcctggatatactatggtgctgcaggttttgagaagcag
atcgaccacgccttcgagcaggctgaataccttgccagtctcatcaaacagagtgacaat
tttgtgcttgtatcgcaggaccctcccccttgtttgcaagtttgcttctattactccccc
gagagaaatctgtctcataacaaagaggagaacacgctccgaaccaagactatggttgag
aagatgatcctcagaggctacatggttgattatgcccctggtccaaatggcagcttcttc
cgtgttgtggtcaactgccagactctgccagggacagtcgagggccttgttaaggctctt
gaggaagttggacggcaatag

DBGET integrated database retrieval system