KEGG   Fusarium verticillioides: FVEG_09866Help
Entry
FVEG_09866        CDS       T04869                                 

Definition
(RefSeq) hypothetical protein
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00061  Fatty acid biosynthesis
fvr00062  Fatty acid elongation
fvr01100  Metabolic pathways
fvr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FVEG_09866
   00062 Fatty acid elongation
    FVEG_09866
Enzymes [BR:fvr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     FVEG_09866
    1.3.1.-  
     FVEG_09866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N_2 NmrA
Motif
Other DBs
NCBI-GeneID: 30067500
NCBI-ProteinID: XP_018756922
UniProt: W7MII5
LinkDB All DBs
Position
1
AA seq 369 aa AA seqDB search
MAAISQIQPSDGKPASVGFHYPKQEQIPPDSIGVDQILVSFLFSPINPQDLLVLAGRYPV
KPLHTLDNQPVLGYDGVARVQAVGPLTNPDQTHIRPGDFIVPRRHGLGTWRSQAILSVTD
VIPLSPTKDLLGASLLRMAFLPAYLLVEDMRDLKPGDWIIQNAGSGTIARLVSQFARLKG
VRTCSVVRDRDGSTLDALKADLQSQGVEIVITETDLAKHGTQASAELADAAAKGRIVLAI
DAVFGDSGERLANALSHGGTYVNYGSLGGASGIIGLSQRLLFWSEVKFRNFRLSEQLKGR
TAAEQESLLLWFQDLLSQGLLRTPPVEIIQVPRDVEGRDEFEGRVKEAVTAGPADKVGRV
KQVLQFGRI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgattagccaaattcaaccctctgacggcaaaccagcctctgtgggatttcat
taccccaaacaagaacaaattccgccagattccatcggcgtcgatcaaattctggtatct
ttcctcttctccccaatcaacccccaagacctcctcgtactcgcaggtcgttacccagtc
aagccgctgcataccctagacaaccaacctgtgctgggttatgacggcgtggctcgcgtc
caagcagtggggcctctgaccaacccagaccagacccacattcggcccggagactttatt
gttccgcgtcgacatggattaggaacctggagaagccaagctattcttagtgtgacggat
gttattcccctgtcgcctacaaaggatcttcttggcgcatctcttctgcgcatggccttt
ctgccggcttacctccttgtcgaggatatgcgtgatctgaagcctggtgattggatcatt
cagaacgcaggttctggaaccatcgcgaggcttgtatcgcagtttgctcgtctcaagggt
gttcgtacctgcagtgttgtgcgtgatcgggatggtagtactctcgatgctctcaaggct
gatctgcagagccagggtgttgagatcgtgatcaccgagacagatcttgctaagcacggt
acgcaggcttcggcagaactcgcggatgctgctgccaagggtcgtatcgtgcttgccatc
gacgcagtctttggtgactccggtgaaagactcgcaaatgccctatctcacggtggaaca
tacgtcaattacgggtctctcggtggtgcaagtggaatcattggtctatctcagcgtctg
ctgttctggtcagaggtcaagtttcggaactttcgtctgtctgaacagctaaagggtcgg
actgcagcagagcaggaatctctcctgctgtggttccaggatctgctttctcagggactt
ttgcgtacgccgcctgtggagatcattcaggtccctcgggatgttgagggcagggatgag
tttgaggggcgtgtgaaggaggctgttactgcaggtcctgctgacaaggtgggaagggtc
aagcaggttttgcagtttggtaggatctag

DBGET integrated database retrieval system