KEGG   Fusarium verticillioides: FVEG_10341Help
Entry
FVEG_10341        CDS       T04869                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
fvr  Fusarium verticillioides
Pathway
fvr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    FVEG_10341
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fvr03400]
    FVEG_10341
Enzymes [BR:fvr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FVEG_10341
DNA repair and recombination proteins [BR:fvr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     FVEG_10341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C BRCT LIG3_BRCT DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 30067935
NCBI-ProteinID: XP_018757529
UniProt: W7MHW7
LinkDB All DBs
Position
9
AA seq 984 aa AA seqDB search
MSQTDEAQREDEIQYGIVGMTREEIEEKFPNRPKNHSKTLVFSELFREVFNPLNENKKQN
ATGTGPRKGFRGVNKLSPHEQRRHIIERFITRWRKEVGPDFYPALRLILPDKDRDRGVYG
LKENTIGKLLVKLMKIDKNSEDGYNLLHWKLPGQTTASRLAGDFAGRCFEVISKRPMRTE
VGNMSIAEVNEQLDKLAASIGEAENLRVFETFYNRMNSEELMWLIRIVLKQMKVGATEKT
FLDLWHPDGDALFSVSSSLRRVCWELHDPETRLEQEETGVALMQCFQPQLAQFQMPSSFE
KMIALLRPTEQDPEFWIEEKLDGERMQVHMVQDKSHPGGKRFCFWSRKAKDYTYLYGDGL
QDENSSLTRHLKNAFASGVKNLILDGEMITWDMGVDKIVPFGTLKTAALSEQKNKSDTDS
AGHRPLFRTFDILYLNNKPLTQYTLRDRHRALEKAIKPVHRRLEIHSYAKATSADAIEPL
LREVVANASEGLVLKNPRSMYRLNSRNDDWLKVKPEYMSEFGESLDCVIIGGYYGSGKRG
GMLSSFLCGLRVTQNHIQAGANPEKCFSFFKVGGGFRAEDYAEIRHRTEGKWIEWDQKNP
PSKYIELGGGELRQYERPDVWIRPKDSVVVSVKAASVGPSDQFARGFTLRFPRFRRLRLD
RTWDTALSLEEFQELKERVDEESKEKAMTVEDRKRRNPKRVKRELIIAGEDAIVPESKGA
TTDLFKGLDFCVLSEALRPYKKTKTQLETIIKENGGTVVQRAVPGTNMVLIADKKVVKVA
SLIKGGAVDIIRPKWIRDCLEQELGAFLLPFEPSHLFHATDELQGAAEDNTDQFGDSYAR
DLSIEELRELMHDIPKIEDGTHFDKDEFLQQLEEHGNDLGRLRSFTFRRCVVLFHAVEAG
DNKISRLKHLVKYGGGNVTNDTNDLSVTHVVIEGDDLMQVGEAADMVRKELSSRRVQPRL
VTGKWIDDCWNESTLLDEEQFMIP
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaactgacgaggcacagcgtgaagacgagatccaatatggtatcgtgggcatg
acccgcgaagagattgaggaaaagtttccgaatcgcccaaagaatcactccaagaccctc
gtcttctcggagctgtttcgagaagtcttcaaccccctcaatgagaacaagaagcagaat
gccactggcacaggccctagaaaaggtttccgtggtgtgaataagctttctcctcatgaa
cagcgtcggcacattattgagcgcttcatcactcgatggcgcaaagaagttggtcctgat
ttctatcccgctttgcgcctaatcctgccagacaaagaccgtgaccgtggagtttatggg
ctcaaagaaaacacaattggaaagttgcttgtcaagcttatgaaaatcgacaaaaattcc
gaagatggctacaacctcttgcattggaagctaccaggtcagactactgcgtcgcgcctg
gcgggtgactttgcaggacgatgttttgaagtcatctcaaagaggccaatgcgcaccgag
gttgggaacatgagcattgcagaagtcaatgagcagcttgacaaactcgcagcttcaata
ggggaggcagagaatctgcgagtctttgagaccttctacaatcgtatgaattcagaagag
ctcatgtggctcattcggatcgtcctcaaacagatgaaagttggggccacggagaagact
ttccttgacttgtggcatccagacggagacgctctatttagtgtgtcatcaagtttaaga
cgtgtttgctgggagctgcatgacccagaaacccgccttgagcaggaggaaactggcgtt
gccttaatgcaatgtttccaaccacaactcgcacaattccagatgccttcatcatttgaa
aaaatgatcgctcttctgcgaccgaccgagcaagaccccgaattctggattgaggaaaag
ttggacggtgagcgtatgcaagtccatatggtccaagacaagagtcacccaggcggcaaa
cggttctgtttttggtcgcggaaagccaaagattacacatatctctacggcgatggtctt
caagacgagaactcaagtctaaccagacatttaaaaaacgcatttgcatctggagtgaaa
aacttgatattggacggcgaaatgatcacctgggatatgggtgtcgacaagatagtgccc
tttggcaccctcaaaacagctgcgctttcggaacagaagaataagtcggatacagactca
gctggccacaggccattgttccgcacttttgatatcctttatctgaacaacaaacctcta
acccaatataccctacgggatcgacatcgagctttggaaaaggctatcaagcctgttcat
cgccgacttgaaattcacagttacgctaaggcaacgagtgccgatgcaattgagcctctt
ctccgcgaggttgtcgctaatgcttctgaaggccttgtgctgaagaacccgcgatctatg
taccgtctcaatagtcgaaatgatgactggcttaaggtcaagcctgaatacatgtccgag
tttggcgagtccctcgactgtgtcattattggtggctactacggttcagggaaacgaggt
ggcatgctatcaagcttcttgtgtggactgcgtgttacgcaaaatcatatccaagctggc
gccaaccccgagaagtgtttcagtttcttcaaggtcggtggcggtttccgtgcagaagac
tatgcggaaattcggcatcgaacagaaggcaaatggattgagtgggatcagaagaatccg
ccatcaaagtacatcgaacttggaggaggagagcttagacagtatgagagaccggatgtt
tggatcagacctaaagactctgttgttgtttctgtgaaagcagccagtgttggaccttca
gatcaattcgctagaggcttcacactaagattcccacgattcagaagacttcgactggac
cgaacttgggatacggccctctcccttgaagagttccaggagttgaaggagcgagttgac
gaagagtcaaaggagaaggcgatgacggttgaggacaggaagcggcgcaaccccaagcga
gtgaagagagagctgatcattgctggggaggacgcaattgtaccggagtccaagggagcg
acgacagaccttttcaagggacttgacttctgcgtgctttcagaagcgctccggccttac
aaaaagaccaagacgcagcttgaaaccatcatcaaggagaatggcggcacagtcgtacaa
cgagccgtgccagggacaaacatggttctgatagccgacaagaaggtggtgaaggtggcg
agcctcattaaaggaggggccgttgacattatccgccccaaatggataagagattgtctc
gaacaggaattgggggcgtttcttttgccatttgaaccttcgcatctgtttcacgctact
gatgaattacaaggagcggcagaagataacacagatcagtttggggacagctacgcgcgg
gatctttccatcgaagaactcagagagctaatgcacgacatccctaagattgaggacggc
acgcattttgacaaggatgaatttctccaacagcttgaggagcatgggaacgacttggga
cgattaaggagctttaccttccgacgctgtgtggtgctgtttcatgccgtggaagctggc
gacaacaagatttcgaggctaaagcaccttgtcaagtacggtgggggtaatgttacaaat
gacaccaatgatctgtctgtgacacatgtggtgatcgagggcgacgacctgatgcaagtg
ggagaggcggctgatatggtacgaaaagaactgagctcaaggcgtgtgcaaccaagatta
gtgacaggaaaatggattgacgattgctggaatgagagcacattacttgacgaggagcag
tttatgattccttga

DBGET integrated database retrieval system