KEGG   Fusarium verticillioides: FVEG_11103Help
Entry
FVEG_11103        CDS       T04869                                 

Definition
(RefSeq) hypothetical protein
Organism
fvr  Fusarium verticillioides
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 30068638
NCBI-ProteinID: XP_018758520
UniProt: W7MWZ9
LinkDB All DBs
Position
9
AA seq 273 aa AA seqDB search
MKPVLALTVCLSGIMGAEAWVMPPGAAPKAGYALRPEDKTGNKNAADTKIKFSPAGSSSS
GTKSEAVVAGFINPKTGGTSRRGLDRRDDDDDDDSSDDGVEGGPEVTTFNRPAFRIGTLK
KGETSGSDDDEEDETKYFKTNNKKQNGKNKDDDDKKKEDKTKTKKPDSTKTKSSDDAKKT
KSRHSGEDDDKKTTKTKKEDSTKTKSSDDVKKTSKSKHSGDDDDKKTTKTKKQSSTKTKS
SDDATKTPKVKDDKKKGSKDNKKVDDKKKPKST
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgttctcgctctcacagtctgcctcagcggcatcatgggcgctgaagcctgg
gtcatgccccctggtgctgcaccaaaggctggctatgctcttcgtccagaggacaagact
ggtaacaagaacgccgccgatacaaagatcaagttctcacccgctggttcttcatcttct
ggtacaaagtcagaggctgtcgtcgctggcttcatcaaccccaagaccggcggtacgtcg
cgtcgtggccttgacaggcgcgatgacgatgatgacgacgatagttctgatgacggtgtt
gaaggtggccctgaggtcaccaccttcaatcgcccagccttcaggatcggcaccctcaag
aagggagaaacctctggcagcgatgatgatgaggaggatgagaccaagtacttcaagacc
aacaacaagaagcaaaacggcaagaacaaggatgacgacgacaagaagaaagaggataaa
accaagaccaagaaaccagacagcactaaaacaaagtccagcgacgatgctaaaaagaca
aagtccagacactctggtgaagacgacgacaaaaagaccaccaagaccaagaaggaggac
agcaccaagacaaagtctagcgatgatgtgaaaaagactagcaagtcgaagcactcggga
gatgatgatgataagaagacgaccaagactaagaagcagagttctacaaagacaaagagt
agtgatgatgcgaccaagacgcccaaggtgaaggatgataagaagaagggttccaaggac
aacaagaaggttgatgacaagaagaagcccaagagcacataa

DBGET integrated database retrieval system