KEGG   Fusarium verticillioides: FVEG_11356Help
Entry
FVEG_11356        CDS       T04869                                 

Definition
(RefSeq) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00020  Citrate cycle (TCA cycle)
fvr00310  Lysine degradation
fvr00380  Tryptophan metabolism
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
fvr01130  Biosynthesis of antibiotics
fvr01200  Carbon metabolism
Module
fvr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fvr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FVEG_11356
  09105 Amino acid metabolism
   00310 Lysine degradation
    FVEG_11356
   00380 Tryptophan metabolism
    FVEG_11356
Enzymes [BR:fvr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FVEG_11356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 30068876
NCBI-ProteinID: XP_018758879
UniProt: W7MMH8
LinkDB All DBs
Position
9
AA seq 1051 aa AA seqDB search
MLRNSLCRASSQLLRGARCSAASSTASISTLSARTSSWKLAASRRSLAVAARRNYATSAT
SAPPDPNDNFLSGSTASYIDEMYMQWRQDPESVHVSWQIYFKNMESGEMPISQAFQPPPN
LVPNMTGGVPRLAGNLAMEDGSDVTNHLKVQLLVRAYQSRGHHTAKIDPLGIRGTNDAKG
FSNIKPKELTLEHYGFTEKDMDTEYTLGPGILPRFKRDGREKMTLREIIDACERIYCGSF
GVEFIHIPDRDKCDWLRERLEVPTPFKYSVDEKRRVLDRLIWSSSFESFLATKYPNDKRF
GLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTNG
AEDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEK
THRTAMSVLLHGDAAFAAQGIVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARST
AYCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKYGHNETDQ
PSFTQPLMYKRITEKEPQIDIYVNKLIEEGSFSKADVDEHKQWVWGMLEESFTKSKDYTP
TSKEWTTSAWNGFKSPKELATEVLATNETSVKSTTLEHIGTVIGSTPEGFHVHRNLKRIL
ANRTKSVVEGKNIDFPTAEALAFGSLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDT
YTPLQHLSQDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIID
QFIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRDFPTGEKLVRQH
QDCNMQIAYMTSPANLFHILRRQLHRQYRKPLVIFFSKSLLRHPLARSNIEEFTGENAGF
QWIIPDPEHETGAIKAPEEIERVILCSGQVWAALHKHRSENNLDNVAITRIEQLNPFPWQ
QLKENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTEHHTRKHVMYAGRNPSAS
VATGLKQVHMKEERELLEMAFTVKQDKLKGE
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggaattcgctctgtagagctagctcgcagctcctccgcggtgctcgatgctct
gctgcctcgtctaccgcctctatctcgactctctcggcccgtacatcatcatggaagctc
gccgcctcccgccgttctctggccgttgctgctcgtcgcaactatgcgaccagcgcaact
tctgcgcctcccgatcctaacgataacttcctctctggaagcaccgctagctacatcgat
gagatgtacatgcagtggaggcaagatcctgagagtgtccatgtctcgtggcagatttac
ttcaagaacatggagagcggcgagatgcccatctctcaagccttccagcctcctcctaac
ctggtcccaaacatgaccggtggcgtccctcgccttgctggcaacctggccatggaggat
ggctccgatgtcaccaaccatctcaaggttcagcttcttgtccgtgcttaccagtctcgc
ggtcatcataccgccaagattgatcccctcggtatccgaggtaccaacgacgccaagggc
ttctccaacatcaagcccaaggaattgactctcgagcactatggtttcacagagaaggac
atggacaccgagtataccctcggccctggtatcctgcctcgcttcaagcgtgatggccgt
gagaagatgactctccgtgagattatcgatgcttgcgagagaatctactgtggttctttc
ggtgttgagtttattcatatccctgaccgtgacaagtgcgactggctccgtgaacgtctt
gaggttcctactccttttaagtactctgtcgatgagaagcgccgtgttcttgaccgactt
atctggagttccagcttcgagtctttcctggccaccaagtaccccaacgacaagcgattc
ggtctcgaaggctgcgagacgcttgtccctggtatgaaggctctcattgaccgcagtgtc
gactatggtgtcaaggacattgtcatcggtatgcctcaccgtggtcgtctcaatgttctc
tccaacgtcgttcgaaaacccaacgagtctattttcagcgagttcgctggtacaaacggt
gccgaggatgagggatctggtgacgtcaagtaccatcttggtatgaactttgaacgtccc
actccctccggcaagcgtgttcagctttctctggtcgccaacccttcgcatctcgaggct
gaggatcccgtcgtcttgggcaagacccgcgctattcagcactacaacaacgacgagaag
actcaccgcaccgccatgagtgttctccttcacggtgatgccgcctttgctgcccagggt
atcgtctacgagtgtctcggcttccactctctccccgccttttctaccggtggtaccatt
cacctcgtcgtcaacaaccagattggtttcaccactgatcctcgattcgcccgatctacc
gcttactgtaccgatattgccaaggccatcgacgcgcctgttttccacgttaacgctgat
gatgtcgaggctgtcaactttgtctgtcagcttgctgccgattggcgcgccgagttccaa
cacgatgttgtcatcgacctcaactgctaccgaaagtacggtcacaacgagaccgaccag
ccttcattcacccaaccgctcatgtacaagcgcatcactgagaaggagcctcaaatcgac
atctatgtcaacaagctcatcgaggagggctctttctccaaggcggatgtcgatgagcac
aagcagtgggtctggggcatgctcgaggagagcttcaccaagtccaaggactacactcct
acctccaaggagtggaccacctctgcttggaacggcttcaagtctccaaaggagctggcc
accgaagttttggctactaacgagacaagtgtcaagagtactactctcgagcatatcggc
acagtcattggaagcacccccgagggcttccacgttcaccgcaacttgaagcgcattctc
gccaaccgaaccaagtcggttgttgagggcaagaacatcgacttccctactgccgaggct
ctggcctttggttctctcgttactgagggctaccacgtccgtgtctccggtcaggatgtc
gagcgtggtaccttctctcagcgacacgctgtcttccacgaccaagagaccgaggatacc
tacactccccttcagcacctgagccaggaccagggcaagttcgtcatctctaactcttcc
ctcagtgagtttggtgctttgggctttgagtatggttactcgctctcctcgccccacgcc
cttgtcatgtgggaggcacagttcggtgactttgccaacaacgctcaatgtatcatcgac
cagtttatcgcctctggcgaggtcaagtggatgcagcgaaccggtcttgtcatgtctcta
ccccacggttacgatggccagggacccgaacactcttctgggcgtctggagcgatacctt
cagctcagcaacgaggatccccgtgatttccccactggtgagaagcttgtccgtcaacac
caggactgcaacatgcagatcgcctacatgacctctcctgccaacttgttccatattctc
cgccgccagctgcaccgccagtaccgcaagcccctcgtcatcttcttttccaagtccctt
ctccgtcaccctctggctcgtagtaacattgaggagttcactggtgagaatgctggcttc
cagtggattatcccggatcctgagcatgagactggtgccatcaaggctcccgaggagatt
gagcgcgttattctctgcagcggtcaggtctgggctgcccttcacaagcaccgttccgag
aacaacttggataacgtcgccatcactcgtattgagcagcttaaccccttcccttggcaa
caactcaaggagaacctcgaccaataccccaatgccaagaccatcgtctggtgccaggag
gagcctctcaacgccggtgcctggagcttcactcagccccgtatcgagactctgctcaac
aacactgagcaccacacccgcaagcacgtcatgtacgctggccgaaaccccagtgcttcg
gtcgccactggtctcaagcaagttcacatgaaggaggagcgtgaactccttgagatggct
ttcactgttaagcaggacaagctcaagggcgagtaa

DBGET integrated database retrieval system