KEGG   Fusarium verticillioides: FVEG_13685Help
Entry
FVEG_13685        CDS       T04869                                 

Definition
(RefSeq) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00220  Arginine biosynthesis
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
fvr01130  Biosynthesis of antibiotics
fvr01210  2-Oxocarboxylic acid metabolism
fvr01230  Biosynthesis of amino acids
Module
fvr_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    FVEG_13685
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     FVEG_13685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Poly_export
Motif
Other DBs
NCBI-GeneID: 30071012
NCBI-ProteinID: XP_018761925
UniProt: W7N7L6
LinkDB All DBs
Position
10
AA seq 377 aa AA seqDB search
MKLITILLTATAATAFDLGSVQLPFSHESLESSALLELHKSLVERPSITGSEKHVTDFLK
AYLQDAGFTVETQAVAKNRDNVLAYYDSTRKTKVLVTSHIDTVPPFWPYERRGDEIWGRG
TVDAKGSVAAQIIAVQELFQKKEVSEGDVALLFVVGEETGGPGMGNVNDLGLSWESVIFG
EPTELKLARGHKGGLGFTIKANGKAGHSGYPETGSNAIDSLVRGLAALQKVELPGSKEFG
NSTLNVGKIEGGVAGNVIPASAFATGGVRVAGGTPEGIRDLIRQAVEESDPSLVVEFSYG
IGPVPTDYDVDGFETVVLNYGTDIPRLKGSHKRYLYGPGSILEAHSAHEHLKVSDLEQAV
EGYKKLITHALDQPSEL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatcaccattctcttgactgccactgcggcgacggcgtttgacctgggaagt
gtccagctcccgttctctcatgaatcactagaatcatcagcacttcttgagttgcacaaa
tcacttgttgagcgaccctcgatcactggttctgagaagcacgtcaccgactttctcaag
gcatacctccaagatgctgggttcactgttgagactcaagcagttgccaagaaccgcgat
aacgtcttggcttactatgatagtacgagaaaaaccaaagttctcgtgacttctcatatt
gacactgttcccccattctggccttatgaacgacgaggtgatgagatctggggtcgagga
acagtcgatgcaaagggcagtgtcgcggcgcagatcattgctgttcaagaactcttccag
aagaaagaggtcagtgaaggcgatgtagcgctgctgtttgtggtgggtgaggagacaggt
ggacccggaatgggcaatgtcaatgatctcggtctatcctgggagtccgtcatcttcggt
gagccaacagagctcaaacttgcccgaggtcacaaaggtggattgggcttcactatcaaa
gccaatggaaaagctggtcattctgggtatcctgagacaggaagtaatgctatagatagc
cttgttcgtggactagcagctcttcaaaaggttgagctacctgggagtaaagagtttggt
aactctactctcaacgtgggtaagattgaaggcggtgttgctggaaatgtcatcccggca
agtgcttttgctaccggaggagttcgagtcgctggcggaactccagagggtatcagggat
ttaatacgtcaggcagttgaggagagtgacccgagcctagtcgttgaattctcttatggt
attggacccgtgcctacggactatgatgttgatggatttgaaactgtggtcttgaactac
ggaacagatatcccgaggctaaaggggagtcataagagatatctgtacggacctggctcg
attctcgaggcgcactctgcgcatgagcacttgaaggtttctgatctggagcaggctgtt
gaggggtacaagaagttgataacccatgcccttgatcagccttctgagctctga

DBGET integrated database retrieval system