KEGG   Fusarium verticillioides: FVEG_14136Help
Entry
FVEG_14136        CDS       T04869                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00052  Galactose metabolism
fvr00500  Starch and sucrose metabolism
fvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FVEG_14136
   00500 Starch and sucrose metabolism
    FVEG_14136
Enzymes [BR:fvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     FVEG_14136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 30071411
NCBI-ProteinID: XP_018762500
UniProt: A0A139YC15
LinkDB All DBs
Position
Unknown
AA seq 977 aa AA seqDB search
MLNYLLALIVFIVTAQAEPSISTVVQSKTASPEIAVAPSLTPTFRDPHAPNPQTCPGYKA
TNIKRDLKGVKADLTIAGPDCQAFGNDIRDLVLEVQYQTKERLNVKIFPKYLSEQNRTQY
ILPDSLVFEPGRDEKTTISNSDLRFEFTNSPNFQFKITRSCDREVLFSTYGHVIVFEDQF
VELVTSMEPDYNVYGLAENIHDFHLGQNFTQTFWTNDAGIEHGNPIDGNIYGVHPFYQES
RYHKGSNTTSHGVYARNAHGQEWLLRPETLTYRTIGGSVDLYFLSGQNKQGGSTAVETMR
QYHTGCVGLPAMQMFWTLGFHQCRLGYDTLDKIEAVVENYRAADIPLEAIWSDFDMFDGF
RSFANNPVTFPPNRMAEWVNWLHENEQYYVPLVWANIYRPNPDDPKDTYGPYERGAKLKA
FIRDPESGDFYTGNNWPGFVVWGDFMLPETHKWWAEELKIWYDSVPYDGMLSDLTEPASY
CVGPCGNSRLDMNPVHVPFLIPGEKLRMFYEYPDGFSVTNHSEFERAKELAANQSAEVQA
AHVFQDPATSTLGRTEPTPGVRNLTYPPYVLNNLQPGHSIRRMTISPDATHNDELNTTEY
QLHNLFGNQISNATYHGLLELFPGRRPFNIARGNFAGIGRYATRWGGDNSSKWGSMFLSI
SHALTHMMAGIPMFGVDICGYSHNASFDLCARWMSLGAFMPFYRNHNMGGTISQEAFVWS
SVAEASRRAIAIRYSLLNYIYTLFHYANTQGDLVMRALAWEFPNDETLKATYSQFLLGAS
LLVTPVLTPNSNKVRGVFPGIGEGTRWYDWYTLSEVHAKPQENVTLDAPLEHINLHIRGG
TVFTLQKPGNTTAATRRNPFSLILALDDNEYAEGSVYFDDGVSLEPEATKTVAYTFREGI
LRAETTGDYEVKPPLVNITVTGLRKAPKSVEFHADKGNQKALLPKLVYNNGTAYVTELEQ
FTRDGGFGHDFEVSFKY
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgttaaactatttgctggctttaatagtattcatagtcacagcgcaagctgagccgtca
atatcgactgttgttcagtccaagacggcctcgcctgagattgcggtcgctcctagtctg
acaccaacattccgggatcctcatgcacccaacccacagacatgtccaggctacaaggcg
acaaatatcaagagggatctcaaaggtgtgaaggcagacttgaccatagctggacctgac
tgtcaggcgtttggtaatgacattcgtgacctggtactcgaggttcagtatcagacaaag
gagagactgaatgtcaagatattccccaagtatctgtctgaacagaacagaactcagtat
atcctaccggactcacttgtattcgagccagggagagatgagaagacgacaatctcaaat
agtgatctcagattcgagtttactaactcaccaaactttcagttcaaaatcacccggagc
tgtgatagagaggtcctgttctcaacgtacggccatgtcatcgtatttgaggaccaattc
gttgaactggtaactagcatggagcccgactacaatgtctatggactagctgagaacatc
catgatttccatctggggcagaacttcactcagaccttctggaccaatgacgctggtata
gagcacgggaaccctatagatggaaacatctatggtgtccatcccttctaccaggagagt
cgataccacaaaggtagcaacaccacttctcacggtgtatatgcccgaaacgctcatggc
caagaatggcttctgagaccagagactttgacataccgcaccatcggtggaagtgttgac
ctctacttcctcagtggccagaacaagcaaggcgggtctactgctgttgaaactatgcgc
cagtatcacactggttgcgtcggcttacctgccatgcaaatgttctggacactgggcttt
caccaatgtcgattgggatatgataccctcgacaagatcgaagctgttgttgagaactac
agagccgctgatattcctcttgaggctatttggtcagactttgacatgtttgatggtttc
cgcagcttcgccaacaaccctgtcactttcccgcctaatcgtatggcagagtgggtaaat
tggcttcatgagaacgagcagtactacgttccgctggtatgggccaacatataccgtccg
aatcctgatgatccaaaggatacttatggtccctatgaacgcggcgccaagctaaaagca
tttatcagagatccagagtcaggtgacttctacacgggcaacaactggcctgggtttgtt
gtttggggagacttcatgctacctgagacacacaaatggtgggctgaagagctcaagata
tggtatgatagcgtaccttatgatggaatgctctctgatcttacagagcccgcttcgtac
tgcgtgggcccctgcggcaatagtcgcctggatatgaaccccgttcacgttcccttcctg
atcccaggggagaagctcaggatgttttatgagtatccagatggcttcagtgtgactaat
cactccgagtttgaaagagcaaaagagcttgcagccaatcaatcagcggaggtccaggct
gcccacgtcttccaagaccctgccactagcaccctaggacgtacggagccaaccccaggt
gtcagaaaccttacatatccaccttatgttctcaacaacctgcaaccaggccactccatc
aggagaatgaccatctctccagatgcaactcacaacgacgagttgaacaccacggaatac
cagttacataatttgtttggaaatcaaatctccaatgcgacttaccacggtctgcttgaa
ctgttccctggtcgccgtccattcaacatcgcccgtggcaactttgctggcatcggccga
tacgctacgagatggggcggtgataactcatcaaaatggggtagtatgttcttatccatt
tcgcatgctctgacgcacatgatggctggcattccaatgtttggagttgacatctgcggc
tactcccataacgccagttttgacctttgtgctcgatggatgtctctgggagccttcatg
cccttctatcgtaatcataacatgggcggtactatatcccaagaagcgtttgtatggtca
tctgttgctgaggcttcgcgtcgagctatagcgataagatatagcctcctcaactacatc
tacaccttgtttcactacgccaatacccaaggcgaccttgtcatgcgggctttggcatgg
gagttcccaaatgacgagacactcaaggctacctattctcagttcttgctgggcgcatcc
cttctggtgacaccagtgctgacaccaaactccaacaaagtcagaggtgtgtttcctggg
attggagagggaacacgttggtatgattggtacacactgagtgaagtccatgccaaacct
caagagaacgtcactcttgatgcgcctttggaacatatcaacctccacatcagaggcggc
acggtattcacattgcaaaaacccggaaatacaactgcagcgacaagaaggaacccgttc
tcacttatcttggccctagacgataatgagtacgctgaaggaagcgtgtattttgacgac
ggtgtcagcctcgagccagaagccaccaagactgtcgcatacactttcagggaggggatt
ctgagagcggaaaccactggtgactacgaagtcaagcctcctcttgtgaacataactgtt
actggtctccgtaaggcacccaagagcgtggagttccatgctgataaaggaaaccaaaaa
gcgctgttgcccaagcttgtatacaataatggcacggcatatgtgacggaactggaacag
tttacacgggatggtggctttggacatgactttgaggtcagtttcaagtattaa

DBGET integrated database retrieval system