KEGG   Gossypium arboreum: 108453486Help
Entry
108453486         CDS       T05776                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gab  Gossypium arboreum
Pathway
gab03030  DNA replication
gab03410  Base excision repair
gab03420  Nucleotide excision repair
gab03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108453486
   03410 Base excision repair
    108453486
   03420 Nucleotide excision repair
    108453486
   03430 Mismatch repair
    108453486
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gab03032]
    108453486
   03400 DNA repair and recombination proteins [BR:gab03400]
    108453486
Enzymes [BR:gab01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108453486
    6.5.1.6  DNA ligase (ATP or NAD+)
     108453486
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108453486
DNA replication proteins [BR:gab03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108453486
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108453486
DNA repair and recombination proteins [BR:gab03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108453486
   NER (nucleotide excision repair)
    Other NER factors
     108453486
   MMR (mismatch excision repair)
    Other MMR factors
     108453486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 108453486
NCBI-ProteinID: XP_017607101
LinkDB All DBs
Position
10
AA seq 1409 aa AA seqDB search
MLPMSSQGTATATKTLALDSTQLYLTAIDSSDSTLSFPPIPSSFPPSKLIPNTRFLVDSF
RHSTTTTFSAAYFLSHFHSDHYSGLSFSWSKGIIFCSHLTSLLLIQTLKIPPHFVFPLPL
NDPVVVDGCEVILVDANHCPGAVQFLFKVPTRNGSFERYVHTGDCRFCNSMKLNSYLNDF
VGCDAIFLDTTYCNPKFVFPSQEESVDYVVSVVDRIGKEFKEKKVLFLVATYVVGKEKIL
VEVARRCKRKIFVDGRKMEILNVLGYGGDKVFTVDESESNVHVVGWNVLGETWPYFRPNF
VRMKEIMEEKGYEKIVGFVPTGWTYEIKRNKFAVRSKDSIEIHLVPYSEHSNYDELREYV
KFLKPKKVIPTVGMDIEKLDSKHADKLRRHFAGLVDEMANKKDFLMGFHRGNYGGVEKVD
MDASPELNEDKDMERKQNILEMKSVESKNADITLNDSSPVQKPDLQDSAIPSEEERERII
EELGDSLPRWVTRDQKLNLISSSRWNVVEAVSNFYEHENELYEQISAFRTSDSASAAQAG
SSDNSVSSLNSGPFRSSSHEGLISHLSQARKPSSFKLSVRSNISTGKRKKSTENKSNKKV
KSNSKLESSGSKQPMITSFFGKVLVDDSKGGGTGLKIEECPKDEITLPGDLTKSYTEKID
QFIQIINGNESSRNYVATLLEKTQGDINRALDIYYGNPEVNHDGNTENMVVSSKSAQVWS
CSNDCPVSKNEHALEESRSIPDSSLQGLPVEHVDVTLVSLPPDKYKPIEHACWRSDQPAP
YVHLARTFDLVGSQRGKIKATSMLCNMFRSLLALSPEDVLPAVYLCTNKIAADHENIELN
IGGSLVTSALEEACGTNRSKIRDMYNDMGDLGDVAQACRQTQTLLAPPRPLLIRDVYSVL
RKISVQTGSGSTMRKKNLIVNLIRSCREKEMKFLVRTLVRNLRIGAMMKTVLPALAQAVV
MNSSRDLCHEGTADCLKEKLQELSTAVTEAYNVLPNLDLLVPSLMKEGIAFSSSTLSMVP
GIPIKPMLAKITNGVPEVLKLFQNKAFTCEYKYDGQRVQIHKLANGAVRVFSRNGDETTL
RFPDLINTIKESAKPAAQTFILDAEVVAIDRKNGQKLMSFQELSSRERGSKDSLITVDKI
KVNICVFVFDIMFANGEQLLGVPLRQRRKCLKDLFHDEKLGHFEYAKEIIVEADDACLTS
KATFTQINSFLEDALQFSCEGIMVKALDIDAGYLPSKRSDTWLKVKRDYVEGLSDSLDLV
PIGAWHGNGRKAGWYSPFLMACYNPDTEDFQSVCRVMSGFSDSFYKEMKEFYSGDRILAK
KPAYYQTAEVPDMWFSPELIWEIRGADFTVSPVHQAAIGLVHPSRGISIRFPRFIRLVTD
RNPEECSTAADVAEMFHSQTRKMDVTAQQ
NT seq 4230 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaatgtcatctcaagggacggccaccgccaccaaaacacttgcgttagactcc
acccaactttacctcactgcaatagactcctccgattccaccctttcttttccccctatt
ccctcctctttccctccctctaaactcatacccaatacccgattccttgtcgactccttc
cgccactccaccaccaccaccttctccgccgcctacttcctctcccacttccattccgac
cactactccggcctctccttttcctggtccaaaggcatcatcttttgttcccacctcact
tccctcctcctcatccaaacccttaaaatcccgcctcatttcgtcttccctttacctcta
aacgaccccgttgtggtagatggctgcgaggtcattctcgttgacgccaatcattgcccc
ggtgctgtccagttcttattcaaagttcccacaagaaacgggagctttgaaaggtatgtt
cacacgggtgattgtcgtttttgtaattcgatgaagttgaatagttatttgaatgacttt
gttggttgtgatgcgatttttttagatactacttattgtaatccaaaattcgtatttcct
tctcaagaagaatcggttgattatgtagttagtgtggtagataggataggaaaggaattt
aaagaaaaaaaggttttgtttcttgttgccacttatgttgttggaaaagagaagattttg
gttgaggtcgcgaggcgatgtaagaggaagatatttgttgatgggaggaaaatggagatt
ttaaatgttttggggtatgggggtgataaagttttcacggtagatgagagtgagagtaat
gttcatgtcgttggttggaatgtattaggcgagacgtggccgtattttcggccgaatttt
gtgagaatgaaagagattatggaggaaaaagggtatgagaagattgttggctttgtgccc
actgggtggacttatgaaattaaacggaataaatttgcagtgaggtcaaaagattcaatc
gagatacatctagtcccttacagtgagcattctaattatgatgagcttagagaatatgtg
aagtttttgaaaccaaagaaggttattcctactgttggcatggacattgagaagcttgac
agtaagcatgctgataagctgagaaggcactttgctggtctggttgatgaaatggcaaat
aaaaaggacttcttgatgggttttcatcgtggcaactatgggggtgtagaaaaagtcgat
atggatgctagtcctgagttgaatgaggacaaggacatggagagaaagcaaaatatattg
gaaatgaaatctgttgagagtaaaaatgcagatattactttgaatgattcatctcctgtg
cagaaacctgatttacaagattcagctataccgagtgaggaggaaagagagagaatcatt
gaggaattaggtgactctttgcccagatgggtgaccagggaccagaaattaaatttgatt
agcagctcaagatggaatgttgttgaagctgtttctaatttttatgaacatgaaaatgag
ttatacgagcaaatctctgcttttagaacttctgattctgcctctgctgctcaggctggt
tcatctgacaactctgtctcatctttgaattcagggccttttagaagtagcagtcatgaa
ggtttaatcagtcatttaagtcaagccaggaagccttctagttttaaactttcagttcgg
agtaacatatctaccggtaaaaggaagaaaagtactgagaacaagtcaaataagaaagta
aaaagcaactcaaaactggaatctagcgggtcaaagcaacctatgataactagcttcttt
ggtaaagttttggttgatgactctaaaggtggtgggactggcttgaaaattgaggaatgc
cctaaggatgaaatcactttgcctggtgacttgactaaatcatatacagagaaaatagat
cagtttattcagataataaatggcaatgaatcgtcaagaaattatgtggccaccttactt
gagaagacccaaggagatatcaacagggcactggatatatattatggtaatcctgaagtg
aaccatgatgggaatacggaaaatatggtagtttccagcaaatcagctcaggtctggagc
tgtagtaatgattgccctgttagcaagaatgaacatgcgctggaggagtcaagatctatt
ccggattcatctttgcaaggactaccagtggaacatgttgacgtaactcttgtatcattg
cctcctgacaaatataaacccattgagcatgcatgctggaggtctgaccagcctgctcca
tatgtccatcttgcacggacttttgaccttgttggcagtcaaaggggcaagatcaaagct
acttctatgctttgcaatatgtttaggagtttgctggccttatcccccgaggatgtgctt
cctgctgtgtatctgtgcaccaacaaaatcgccgctgatcatgaaaatattgaattgaat
attggcggtagtttggttacatctgcactggaagaagcttgtgggactaaccgttcaaaa
ataagggatatgtacaatgacatgggtgatcttggtgatgttgcacaagcatgccgacaa
acccaaactttacttgctcctccacgaccactattaattagggatgtatattctgtgctt
cggaagataagtgtacaaacaggcagtggcagcaccatgcggaagaaaaaccttatcgtg
aatcttatacgttcatgtagagagaaagagatgaagtttctagtgagaactttggtcagg
aatttgcgaataggagcaatgatgaaaactgttcttcctgcactggctcaagcagttgtc
atgaattcttctcgtgatctttgtcatgaagggacagcagattgtctaaaagaaaagctc
caggaactttctacagcagtaaccgaagcatataatgtacttccaaatttggatttgctt
gttccttcactaatgaaggaaggtattgcattttcatcatcaaccttgtcaatggttccg
ggaatacctattaaacccatgcttgcaaaaattaccaatggggttccagaagtactgaag
ctttttcaaaacaaagcttttacatgtgaatataaatatgatggtcagcgtgtccagatt
cacaaattggctaatggagcggtgcgtgtcttttcacgaaatggggatgaaacaacatta
agatttccagatttaattaatacaattaaagaatctgctaagcctgctgcccagactttc
atattggatgctgaggtagttgcaattgataggaagaatggtcagaagctgatgtccttc
caagaattatcttcaagagaaagagggagcaaagattctttgatcacagtggacaaaata
aaggttaatatttgcgtatttgtgtttgacatcatgtttgctaatggagagcagctgcta
ggtgttcctctacgccaaagaaggaaatgtttgaaggatttgtttcatgatgagaagttg
ggtcattttgaatatgcaaaagaaatcatagtggaagcagatgatgcttgtttgaccagt
aaggccacatttactcagataaactcttttctcgaagatgcattgcagttctcatgtgaa
ggaattatggttaaagccttagatattgatgctggataccttccgtcaaaacgtagtgat
acatggttaaaggtgaagcgagactatgtggaaggattaagcgattcccttgatttagtc
ccaattggtgcttggcatggcaatggaagaaaagcgggatggtacagccccttcctcatg
gcatgctacaacccagacactgaagattttcaaagtgtatgtcgtgttatgtctggattc
tctgattcattttacaaagagatgaaagagttctattcgggggataggatcttagccaaa
aagccagcttactatcaaacagctgaggtgcctgatatgtggttctctccagaacttatt
tgggaaataagaggtgcggacttcactgtatcaccggttcatcaggctgcgatagggtta
gttcatccgtcgcgtggcatctcaataagatttcctaggttcattcgcttggttacagat
cgaaaccctgaggaatgtagcacggcagcagatgtagctgaaatgtttcattcgcagact
cgaaagatggatgtgacggcccaacaatga

DBGET integrated database retrieval system