KEGG   Gossypium arboreum: 108453843Help
Entry
108453843         CDS       T05776                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gab  Gossypium arboreum
Pathway
gab04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:gab00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108453843
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108453843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu DUF5549
Motif
Other DBs
NCBI-GeneID: 108453843
NCBI-ProteinID: XP_017607671
LinkDB All DBs
Position
10
AA seq 214 aa AA seqDB search
MAAHIFTTTPSHLALSFPSSTNPSNPPVLFSSFRGVSLKLPRQSLSLAATIPKKAFSVFA
VTKKAVAVLKGNSEVEGVVTLTQENDGPTTVNVRITGLTPGPHGFHLHEYGDTTNGCMST
GAHFNPNNMTHGAPEDEVRHAGDLGNIIANADGVAEATIVDNQIPLSGPNAVVGRAFVVH
ELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccatattttcacgacaaccccgtcccacctcgctctctcttttccatcctca
actaacccttcaaacccaccggttcttttctcctcatttcgtggggtctctcttaagctc
cctcgtcaatccctctcccttgctgccactattcccaagaaggccttttctgtgtttgct
gttaccaagaaagctgtcgctgttcttaaaggtaattcggaagttgaaggcgttgtcacg
ttgacccaggaaaatgatggtcctacaactgtgaatgttcgaattactggtcttactcct
gggcctcatggcttccacctacatgagtatggtgacacaacgaatgggtgcatgtctaca
ggagcacatttcaatcctaacaatatgacacatggtgctcctgaggatgaagtacgccat
gcgggtgacctgggaaacataattgctaatgctgatggagtggcagaggcaacaattgtg
gacaatcagataccactaagtggccccaatgcggttgttggaagagcatttgtggttcat
gagcttgaggatgatcttggaaagggtggacatgaacttagtctaaccactgggaatgct
ggcggaagattggcatgtggtgttgttggcttgactccggtataa

DBGET integrated database retrieval system