KEGG   Gossypium arboreum: 108454113Help
Entry
108454113         CDS       T05776                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
gab  Gossypium arboreum
Pathway
gab00040  Pentose and glucuronate interconversions
gab00051  Fructose and mannose metabolism
gab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    108454113
   00051 Fructose and mannose metabolism
    108454113
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     108454113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 PALP Sacchrp_dh_NADP UDPG_MGDP_dh_N TrkA_N Sipho_Gp37 Methyltransf_25 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 108454113
NCBI-ProteinID: XP_017607926
UniProt: A0A0B0NES3
LinkDB All DBs
Position
11
AA seq 364 aa AA seqDB search
MGKGGKSHEETKSGEDENMAAWLVGLNTLKIQPFKLPPLGPHDARVRMKAVGICGSDVHY
LKTMRCADFVVKEPMVIGHECAGIIEEVGSEVKNLVPGDRVALEPGISCWRCDLCKDGRY
NLCPEMKFFATPPVHGSLAHQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANIG
PETNVLVMGAGPIGLVTMMAARAFGAPRIVIVDVDDNRLSVAKNLGADGIVKVSTDMQDV
AEEVERICKAMGGGVDVSFDCAGFNKTMSTALSATRAGGKVCLVGMGHHEMTVPLTPAAT
REVDVIGIFRYRNTWPLCIEFLRSGKIDVKPLITHRFGFSQKEVEEAFETSAGGGSAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggagggaaatctcacgaagaaaccaaaagtggagaagatgaaaacatggct
gcttggcttgtgggtctcaacaccctcaagattcaaccattcaagctccctccattggga
ccccatgatgccagagttaggatgaaggctgttggtatctgtggaagtgatgttcactac
ctaaagacaatgaggtgtgctgattttgtggtgaaagaaccaatggtgattgggcatgag
tgtgctggaatcatagaggaggttgggagtgaagtcaagaatttagtgccaggagaccgt
gtggctttggaaccggggatcagttgctggcgatgtgatctttgcaaggatggtcgatac
aatctatgccctgaaatgaagttttttgccactccaccagttcatggttctcttgcccat
caggttgtgcatcctgcagatttgtgtttcaaactgccagacaatgtgagcttggaagaa
ggggccatgtgcgagcccttgagtgtgggggttcatgcttgtcgccgagctaatatcggc
cctgagacaaacgtgttggttatgggggcgggacctataggtcttgttacaatgatggca
gctcgtgcttttggggcacctaggatcgtcattgtagatgtagatgataatcgcctatct
gttgctaagaatcttggtgctgatgggattgttaaagtttcaactgatatgcaggacgta
gctgaagaagttgaaagaatatgtaaagcaatgggaggaggagtggatgtaagctttgac
tgtgcaggctttaacaaaacaatgtcaactgctctgagtgccactcgtgctggtggcaag
gtctgccttgtgggaatgggccatcatgagatgactgttccgcttactccagctgctaca
agggaggtagatgtgatcggaatcttccggtataggaatacatggcctttgtgcatcgag
tttctaagaagtgggaagattgatgtgaagcctctgataacccacaggtttgggttttca
cagaaagaagtggaagaagcttttgaaaccagtgctggtggcggcagtgccattaaggtc
atgtttaatctgtga

DBGET integrated database retrieval system