KEGG   Gossypium arboreum: 108456394Help
Entry
108456394         CDS       T05776                                 

Definition
(RefSeq) serine/threonine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
gab  Gossypium arboreum
Pathway
gab03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    108456394
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gab01001]
    108456394
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gab03032]
    108456394
   03400 DNA repair and recombination proteins [BR:gab03400]
    108456394
Enzymes [BR:gab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108456394
Protein kinases [BR:gab01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   108456394
DNA replication proteins [BR:gab03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108456394
DNA repair and recombination proteins [BR:gab03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    108456394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FATC TAN P22_AR_C
Motif
Other DBs
NCBI-GeneID: 108456394
NCBI-ProteinID: XP_017610475
LinkDB All DBs
Position
11
AA seq 3033 aa AA seqDB search
MVTSSDVQEIVSKLSSDKAKAREDGIKLLTMWLEGERSIGFCKVIGQNTAKLKPNEIPQS
ETWPFLIKLLTQCVSLEISTSKRRPPKLIFAKTLRTAIQRAEDTKFPGNVYPLLSVVKTL
FSHILDVINNVPSFQSEYGIILRHLLLVKEYRFHMRKNVYSGLMVFYLEKVATTLTEKNN
TQYSQKEEIFRSILALHSLLENPAGDFPDHLREDIVKGFVKIFSYIRDEGKVSRKLIECI
NTYLLKDGPNLSCQSLEIHNAVQQFVFRCWLMTHDKGLKDALVLYARLQLNLVRGVTEGS
LLVEQLLDVISKELDQSNSSIPGTSWRDGTKDDKFGTLSSSQQHLVELAALVLYRACATT
SRATSNEKRVKRESTAARLKEELVKGKWLWNVTFCYLIRNYYTRISKDLFIYWFEGICAS
FERILNDANVEHAYDGLLWTLRSLQELSLMELPSNAQVEISLRSSLTSKEFDCGWQLIWS
HLMHGLPTFSNVTPVVDAALALLGSIISNDLSNTCVVPHDAWDLRLFKGMPSLCTLYFIA
CYFSRKGSQGDLRDILHLRKYLLRATLGSLSWNEPSLLNERLVLLLPAAVYALCAGCEPF
TQCYKEIHLLQSFVDVIEVADDWIKADEYDHEKQLENFECSIEVLANIDLDSIIQVSSFH
FHQSLRLPRQLRESLMQEMESCILGLLADLKFEKKPLSDIFFICALLCNFIYGLYFSRNR
EEVSSFLSKLGQFLLELLNYAVNVIQENKNDSRSLGFLGFTSSFNQKSAIVVSFKTFVLG
PLFTQRRDGDALDVVLYDAVKQSLQKLLKAFTELYDEYTESITNLRSELLASDSSGSDSS
IRISNHADSNKSRIMDMELDVDEDGKDMTIQTSSGKTPSGGSFSAVKWKLGMVSLISSFF
LVLHDKTWDVLSNLLGKELDFKVYEVILCNLCRRLPSLYSSKLTDLVNLIDNRIRVQVSQ
KLDCFNILAAIGCLLDTLLSLDVEKDKHGVVALEEREAKQSLVYLGELVGKVAEFDLLNW
FGRVKLIDCICNFVLLSPEVGQTMIEKLLSMLHDPDYRVRFILSRRIGVLFQTWDGHGEL
FRDICSNFGIELIFYSKEKLVTAREVLAAGPQPRQKVETVIVTLMQLALHSENIELEAVF
MMCAVSSIDPCQRELVNAALDNLARKLNYMSRMKYLEELIGSILFCWVACGVSIAALVEI
RQLFVLDAEPSYFLQYCFHWLLPALFIHEDNSNLNWVSKIAGQPLTVMVKDHFVPIFSVC
MTLHCSKSSGFEKGAMVLQNSILHFAEISESERDELIKKNMVSIVSHILSLASCASDPII
PFFSRDTIARAIQTVVDGFLEMDDHCASISVVDKINIFRPDRVFMFIVEMHYKIAAAIHH
RHRCHRLASIEVLITVLGHRAALSSTSNYLFNLIGQYIGCHALQDQCCCIISSLLKTFKS
NPSKEIVGVLGEQLQFLVSKLVACCIPLEAEGQRSATVSSLFLSLLLELTVESDPSLYDY
IRELEPFPEIDIFERIRNFHQDLCRAYSPRDHLLKIVKRSCNLPPRLLSWSLQALHKKLL
AGETFQGGKTTKEFVDDTYWHGDGEIVHAVWTLVRMCASDDSSRIRGLVSDLISRVGIGD
PHSVVFHLPRDSNHMHVHGPISHNGASEIMGSSVSEELLIALLKVLKKYLMDDSVKIVDI
TSQTLRGILSTERGQKAILSFDSYERSLIEVHSKGINSELVEKLLMDLEKKFKAEHIFLE
KSTTWVTHGKTFEMWICPVVYSLVGYCSDVILRLCQDVVLLKPEVAELLLPSVVVNLAGR
KDIGVNIQNLISDQVQEHIFVKSNKLIKSIQVWLNALNELRICYVLERSSGPLRKENSKH
CRPSNFSSRSHSSMKPRDSVATLSAVTMSTSSWAKVYWLSIDYLIVARSAIICGSYFTSM
MYVEYWCEEHFHGLTLGNPDFSNLEMLPQHIEILISAITQINEPDSLYGIIQSHTLTSQI
ITFEHEGNWNKALEYYDLQVRSEATAHMDGSSRTLSLTETQSLSQPHLSTSDDEAKRKPY
KGLIRSLQQIGCRHMLDLYCQGLTSGKGXFPTCCLSKYLQYEAAWRAGNWDFSLLSAGPI
PQSSEQHTKTHHFNENLHCCLRALQEGDSDEFQRKLKHSKEELVWSVSRASEESTEFIYS
TIIKFQILYHLGIVWEMRWPTSSFERIELQKHKQKMFSDPVIPTMDQFLWLNKDWSSMLT
KSQLHMSLLEPFIAFRRVLLQILNCHDCTMQHLLQSASTLRKGSRFSQAAAALHEFKFLC
VRTGEQGSSAYWLGRLEEAKLLRAQGQHEMAIGLGKYILQTNRLDEEASDVYRLVGKWLA
ETRSSNSRTIFEKYLKPAVSLAEGNKTADKKSAERKSQTHFRLAHYADALFRSYEERLNS
NEWQAAMRLRKHKTLELEALMRRLKGSTKGDKIDYSVKIQELQKQLAMDKEEAQKLQDDR
DNFLNLALEGYKRCLVIGDKYDVRVVFRLVSLWFSLSSRQDVVNNLLKTIDEVQSYKFVP
LVYQIASRMGNIRDGIVPNNFQFALVSLLKKMAIDHPYHTIFQLLALANGDRIKDKQRSR
NSFVVDLDKKLAAENLLEELSAYHGPVIRQMKQMVEIYIKLAELETKREDTSRKVPLPRE
IRSVRQLELVPVVTASFPVDRSCRYCEGSFPYFRGLADSVMVMNGVNAPRVVECLGSDGH
KYKQLAKSGNDDLRQDAVMEQFFGLVNTFLQNHSDTWKRRLVIRTYKVVPFTPSAGVIEW
VDGTLPLGEYLIGSNRNGGAHGRYGIGDWSFLKCREHMSNEKDKRKAFQEVCETFRPVMH
YFFLERFLQPADWFEKRLAYTRSVAATSMVGYIVGLGDRHTMNILIDQATAEVVHIDLGV
AFEQGLMLKTPERVPFRLTRDIIDGMGAAGVEGVFRKCCEETLSVMRTNKEALMTIIEVF
IHDPLYKWALSPLKALQRQKETDYDLDTSIEGSQDDYEGNKDAARALLRVKQKLDGYEEG
EMRSVHGQVQQLIQDAIDPERLCQMFPGWGAWM
NT seq 9102 nt NT seq  +upstreamnt  +downstreamnt
atggttacttccagtgatgttcaagagatcgtatctaagctgtcctccgataaagctaaa
gcccgcgaagacggaataaagttgctgactatgtggttagagggagaaagatctatcgga
ttttgtaaagttataggacagaatactgcaaaacttaaaccaaacgagattcctcagtcg
gaaacatggccatttcttattaagttgcttacacagtgtgtatcattggagatatcaaca
agcaagcggcgaccacctaagttaatttttgcaaaaactcttcgaactgccattcaacgt
gcagaagatactaagtttcctggaaatgtgtatccattgttgtctgtggttaaaacactt
tttagtcacatactggatgtgataaacaatgttccaagctttcaatctgaatatgggatt
atattacgacaccttttgctggtcaaagagtatcgatttcatatgaggaagaacgtttac
tctggtcttatggttttctacttggaaaaggtggcaacaacattgacagagaaaaataac
acccaatatagtcagaaagaggagatctttcgcagcatcctagcccttcattctcttcta
gaaaatcctgctggagatttcccagatcaccttagggaagacatcgtgaaggggtttgtt
aagatattttcttatataagggatgagggaaaagtttctcgcaagctaattgagtgtatt
aatacatacttgttaaaggatggtccaaatttgagttgtcagtccttagagatccataat
gcagtacagcaatttgtttttcgctgttggctgatgacacatgataagggtcttaaggat
gcgcttgttctttatgcaaggttacaactaaatttagttagaggtgtaactgagggaagt
ttattggttgaacaactcttggatgtcatatctaaagaactagatcaaagcaattcttca
attcctggtacttcatggagagatggaaccaaggatgataagtttggaaccttgagtagt
tctcagcaacatttggtggagcttgcagcacttgtattgtatcgggcatgtgcaactaca
agcagagcaacatcaaatgaaaaacgtgttaaaagagagagtacagctgcccgtttgaag
gaggagcttgtaaaaggaaaatggttatggaatgtgacattttgttatctcattcgtaat
tactacactcgcatcagtaaggatctttttatctactggtttgaaggcatttgtgcaagc
tttgaaagaatcttgaatgatgcaaatgtggagcatgcatatgatggtttactatggact
ttgcggagtctgcaggaactctcattgatggagctgccttcaaatgctcaagtggagatt
tcactgaggtcatctcttacctcaaaagagtttgattgtggttggcaactaatatggagc
catcttatgcatggattaccaacatttagcaacgtaactccagtggtagatgctgcactg
gctctccttgggagcattatttcaaatgatttgtcaaacacatgtgttgtgcctcatgac
gcatgggatcttcgattatttaaaggaatgccttccctgtgtactctgtacttcattgct
tgttatttttctcggaagggatctcagggtgacctgagggacattttacatctacggaag
tatcttctaagagcaactttgggctctcttagctggaatgaaccttccttactaaatgag
cgcttggtattattgttaccagcagcagtttatgctctttgtgctgggtgtgaacctttt
acccagtgttacaaagaaattcacctgttacagtcttttgtggatgttattgaggttgca
gatgattggatcaaggctgacgaatatgatcacgaaaagcagcttgaaaattttgaatgc
tctattgaagttcttgcaaatattgatttggattcaattattcaggtttcctcatttcat
tttcatcaaagtttacgtcttcctcgacaattgagagagtcgcttatgcaagaaatggag
tcctgtattttgggacttttagcagatctcaagtttgaaaagaagcctttgtctgatatc
ttcttcatatgtgctctactatgcaatttcatttatggattatatttttcgaggaataga
gaagaagtttcatcatttctctcaaaattgggccagtttttgttagaattgctgaactat
gctgttaatgtaattcaagaaaacaaaaatgattccagatctcttggatttttgggcttt
acttccagctttaaccaaaaaagcgctattgttgtttcatttaaaacctttgttcttggt
ccccttttcacccaaaggagagatggcgatgccctggatgttgtactttatgatgctgta
aagcaatccctgcagaagcttctgaaggcttttactgaactgtatgatgaatatactgaa
agtataaccaaccttaggtctgagttattggcatcagattcttctggatctgattcttct
atacggatttctaaccatgcggatagcaataagagtaggatcatggacatggagttagat
gtagatgaggatggcaaagatatgactattcagacatctagtgggaaaactccgtctggt
ggatctttctctgcagtgaagtggaagttgggtatggtatcgctaatctcaagttttttc
ttggttctgcacgataagacttgggatgtcctatcgaacctcctgggaaaagaacttgac
tttaaggtgtatgaggttattttgtgcaatctttgtcggcgccttccctcattatattct
tcaaagctgacagatctggtcaatttaatagataacaggatcagagtgcaagttagtcag
aagcttgattgttttaacattctagctgctattggttgtttgcttgatacccttctttct
ttggacgttgaaaaggataaacatggtgtcgtagctttggaagaaagagaagctaaacag
tccttggtgtatcttggggagctggttggcaaagttgcagaatttgatcttcttaactgg
tttggtcgtgttaagctaattgactgcatatgcaattttgttttactcagtcctgaggtt
ggccagacaatgattgaaaagctgctttccatgctccatgatcctgattatcgagttagg
ttcattctaagtaggcgcattggtgttctattccagacctgggatggccatggagagctc
tttcgtgatatttgttctaactttggcatcgagttgatcttttactccaaagaaaaactt
gttacagctcgggaagttcttgctgctggtccacagcctcgtcaaaaagttgaaactgtc
attgttaccctaatgcagcttgctttgcatagtgagaacatcgaattagaggctgttttc
atgatgtgtgcagtttcttccattgatccttgtcagagggaattagtaaatgcagcactt
gataatttggcaagaaagctaaactatatgtcaagaatgaagtacttggaagaacttatt
ggatccattttattttgttgggttgcttgtggtgtcagcatagctgctcttgttgagata
cgacaactttttgtattagatgctgaacctagttatttcttgcaatattgtttccattgg
cttcttccagctttatttattcacgaggacaactctaacctgaactgggtttctaagatt
gctggtcaacctttgactgttatggttaaggatcatttcgtgccaattttttcagtttgt
atgacactgcattgcagtaagagctctggttttgagaagggagcaatggtgcttcagaac
tctattttacattttgctgagatctctgagagtgaaagagatgaactcataaagaaaaat
atggtgtctattgtcagccatattctttctcttgcatcttgtgcatcagatccaattatt
ccttttttctccagggatactattgcccgtgcaatacaaacagttgttgatggatttttg
gaaatggatgatcactgtgcaagtattagtgttgttgacaagattaatatctttcgtcct
gacagagttttcatgtttattgtagaaatgcattacaaaattgcagcagctattcatcac
aggcacagatgtcatcggttagcttcaatagaggtgcttataaccgttcttgggcataga
gctgcgctttcaagtacatccaattatcttttcaatttgattggccaatatattggttgc
catgctttacaagatcagtgctgttgtataatttcttccttactcaaaacttttaaaagc
aacccatctaaggaaattgttggtgtgcttggtgaacaactccagtttttggtatcaaag
ttggtggcatgttgcattcctcttgaagctgaagggcagcgttctgcaactgtatcatct
ctatttttgtctttgcttcttgagctaacagtggagtctgatccttctctttatgattat
attagagaattggaaccctttcctgaaatagatatctttgaacgaataagaaacttccac
caggatttgtgccgagcatactctccaagagaccatttattgaagattgtgaagaggtct
tgcaaccttccgccaagattactttcatggagtctacaggcactgcacaagaagctactt
gcaggggaaacatttcagggagggaagactactaaagaatttgtggatgatacatattgg
catggtgacggggaaattgtgcatgcggtttggacacttgttcgcatgtgtgcttcagat
gattctagtaggattagaggattggtgtctgatttaatatccagggttggcattggagat
ccacactctgttgtttttcatctccccagagactctaaccatatgcatgttcatggaccc
attagtcataatggtgcttctgaaatcatggggtctagcgtatctgaagagcttctaata
gcacttttgaaagttttgaagaaatacttaatggatgattctgttaaaatagttgatata
acgtcacaaacacttcggggaatactttcaactgaaaggggtcaaaaagctatattatca
tttgattcttatgaaagatctttgattgaggttcactctaaaggcattaactctgagctg
gtggaaaagttgttaatggatctggaaaagaagtttaaagctgaacacatttttctggag
aagtcaacaacttgggtgacgcatggtaaaacttttgagatgtggatatgtccagttgta
tactcattggttggctactgcagtgatgtgatcctaagactatgtcaggatgttgtgctg
ctgaaaccggaagttgcagagcttcttttgcccagtgttgttgtcaatttagctggaaga
aaggatattggtgttaatattcagaatttgatttctgatcaggttcaggagcatatattt
gtgaagtcgaataagttgataaagtctatacaagtttggttgaatgcccttaatgaactt
cgaatatgttatgttctggaaagatcttcggggccattaagaaaggaaaattctaagcat
tgcaggccctctaattttagttcaagatcccattcctcaatgaaacctagagattcagta
gctacattgagtgcagtgaccatgtcaacatcttcatgggccaaggtatattggctttct
attgattatctcattgtagctaggtcagcaattatttgtggctcttactttacatccatg
atgtatgtggagtattggtgtgaagaacattttcatggcctcacccttgggaaccctgac
ttttccaatcttgagatgttaccgcagcacattgaaattcttatctcggcaatcactcaa
ataaatgaaccagacagcttatatgggattatccagtcacacacattgacctcccaaatt
attacctttgagcatgagggaaactggaacaaggccctcgaatattatgacttacaagtg
cgatctgaagccacagctcacatggatggaagttctagaactctatcattaacagagacc
caatctttgtctcaacctcacctttccacatcagacgatgaggctaagaggaaaccttac
aaagggctgattagatctttgcagcaaattggttgtaggcatatgctagatttgtattgc
caaggattaacttctgggaagggtntctttcccacttgttgcctgagcaaatatttgcag
tacgaggctgcttggcgtgcgggaaactgggatttctctttactttcagcaggacctatt
cctcaatcttcagagcaacatactaaaactcatcatttcaatgaaaatttgcactgttgc
ctaagagcattgcaggagggagattctgatgaatttcagagaaagttgaagcattcaaaa
gaggagcttgtttggtctgtttctcgtgcaagtgaggaaagcactgagtttatctactca
acaataattaagtttcagatcctgtatcatcttggtatagtatgggaaatgcgctggcca
acatcttcatttgaaagaattgaacttcagaaacataagcagaaaatgttttcagatcct
gtaatccctacaatggatcagtttttgtggctgaataaggactggagctcaatgttgacg
aaatctcagctgcatatgagtttgttagaaccatttattgcatttaggcgagttctactt
caaatcttgaattgtcatgactgtacaatgcaacatcttctgcagtctgcatccactctt
cgtaagggctctcggttttctcaagctgctgcagctttgcatgaatttaagtttctttgt
gtgagaactggagaacaaggttcatctgcatattggcttggaaggcttgaggaagcaaag
ctgttgcgtgctcaaggtcagcatgaaatggccatcggccttggaaaatacatcttgcag
actaatcggttggacgaagaagcttcagatgtatatcgattggttgggaagtggttggca
gaaactagatctagcaactcaagaaccattttcgagaagtatttaaaacctgcagtgtca
cttgctgaaggtaacaagactgctgacaagaagtcagcagaaagaaaaagtcagactcat
ttccgccttgcacattatgcagatgctcttttcagaagttatgaggaaagacttaattcc
aatgaatggcaagcagcaatgcgtttaagaaaacataagacattggaactagaagccctt
atgcgacgtctgaaaggttcaacaaagggggacaaaattgactactcagtgaaaatacaa
gagttgcaaaagcaacttgcaatggacaaggaagaagctcaaaagttgcaggatgacaga
gacaattttctcaacctagctttggagggctataaacgttgcttggtcataggtgacaaa
tatgacgtaagagtggtgtttcgacttgtatcattgtggttcagcctttcatctagacaa
gatgttgtcaacaacttgcttaaaacgattgatgaggttcaatcttataaatttgttcca
ctggtttaccaaattgcttcaagaatgggaaacattagagatggaattgtgcctaataat
tttcagtttgccttggtttctcttctgaagaaaatggccattgatcatccctaccataca
atcttccagcttctagctctcgcaaatggtgatcgtatcaaggacaaacagcgtagcagg
aactcttttgtcgtggatttggataaaaagcttgcagcagaaaatctcttggaagagtta
tcagcataccatggacctgttattagacagatgaaacaaatggtggagatttatatcaag
cttgcagaacttgagaccaagagagaggacactagtagaaaggtaccactgccaagagaa
attcgcagtgttcgacagctggaacttgtacctgtagtgacagctagctttccagttgac
cgtagttgtcgatactgtgaaggctctttcccatacttcagaggattggcagactcggtc
atggtaatgaatggtgtaaatgctccaagagtggttgaatgcttgggttctgatggtcat
aaatacaagcagctcgcaaaatctgggaatgatgacctaagacaagatgctgttatggaa
caattttttggactagtaaatactttcctacagaatcatagcgatacatggaaaaggaga
ttagtcatacgtacatacaaggttgttcctttcactccaagtgctggtgttattgaatgg
gttgatggcacacttcctcttggggaatatcttataggaagcaataggaatggcggtgca
catggtcgctatggaatcggagactggtcatttctaaaatgccgagaacacatgtcaaat
gaaaaagacaagcgcaaagccttccaggaagtttgtgagaccttcagacctgtcatgcat
tacttttttctagaaagatttcttcaaccagctgattggtttgagaaaagactagcttac
acgcgaagtgtagcagctacttcaatggtgggttatattgttggccttggagatagacat
actatgaatattttgattgatcaggccacagcagaagttgttcacattgatcttggtgtt
gcttttgaacaaggtttaatgctcaagacaccagagagggttccgttcaggctaacaaga
gacatcatcgatggcatgggtgctgctggagtggaaggtgttttcagaaaatgttgcgag
gaaactctctctgtaatgcgaacaaacaaagaagctctaatgactattatcgaggttttt
atccatgatcctctttataagtgggctttatcacccctgaaggctttgcagcgtcaaaag
gaaacagattacgatttggatacaagcatagaaggttcccaagatgattatgaaggtaat
aaggatgctgcacgtgctctcctgcgtgtaaaacaaaagttagatggatatgaagaaggt
gaaatgagaagtgtccacgggcaggttcagcaactaattcaagatgccattgatcctgag
agattatgtcagatgtttcctggatggggagcttggatgtga

DBGET integrated database retrieval system