KEGG   Gossypium arboreum: 108461370Help
Entry
108461370         CDS       T05776                                 

Definition
(RefSeq) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ-like
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
gab  Gossypium arboreum
Pathway
gab00061  Fatty acid biosynthesis
gab00780  Biotin metabolism
gab01100  Metabolic pathways
gab01212  Fatty acid metabolism
Module
gab_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    108461370
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    108461370
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gab01004]
    108461370
Enzymes [BR:gab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     108461370
Lipid biosynthesis proteins [BR:gab01004]
 Fatty acid synthase
  Component type
   108461370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 108461370
NCBI-ProteinID: XP_017616696
UniProt: A0A0B0MEY6
LinkDB All DBs
Position
2
AA seq 221 aa AA seqDB search
MAVASNSLVSFIHGSLSQPGRTSHFLPSPSLSFPGSRSLSLKLTRRSNSPLLCSLDATNA
TDKDTPIETRFPAYPTVMDINQIREILPHRFPFLLVDRVIEYNPGVSAVGIKNVTINDNF
FPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGVDKVRFRKPVIAGDTL
VMRMTLIKLQKRFGIAKMEGKAYVGTDLVCEGEFLMATGST
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgcttccaactcgctcgtttctttcatccacggctcattgagtcaacccgga
aggacctcccactttcttccttcaccttctctttctttccccggatctcgctcgctctct
ctgaaactcacccgccgctccaactcgccccttctttgctctttagatgcaaccaacgcc
acagataaggacaccccaatcgaaacaaggttcccagcttatccaactgtgatggacatc
aatcaaataagagagatattaccacacagattcccattcttgttagtggatagagtgata
gaatataatccaggggtatcggctgttggtataaagaacgtgaccataaatgataacttt
ttccctggacatttccctgagaggcccataatgcctggtgttctcatggttgaggcgatg
gcccaagttggaggtctagttatgctgcaacctgaggtgggaggttctcgggaaaacttc
ttttttgctggagttgacaaagtaagatttaggaaaccagtcattgcaggagatactttg
gttatgaggatgacacttattaagctgcaaaagcggtttggaatcgcaaagatggaaggg
aaagcatacgttggaactgacttggtatgcgaaggtgagttcttgatggctactggtagt
acttga

DBGET integrated database retrieval system