KEGG   Gossypium arboreum: 108461459Help
Entry
108461459         CDS       T05776                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit pprA
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
gab  Gossypium arboreum
Brite
KEGG Orthology (KO) [BR:gab00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gab01009]
    108461459
Protein phosphatases and associated proteins [BR:gab01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108461459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 XOO_2897-deam
Motif
Other DBs
NCBI-GeneID: 108461459
NCBI-ProteinID: XP_017616800
LinkDB All DBs
Position
13
AA seq 338 aa AA seqDB search
MQNQTEPPPETNSDKDDQAMEFDLSSTTALDLTSFQLHDLDSVELPSSLTELDLTANRLS
KLDPRIANLINLRKLSFRQNLIDDAAIESISSWGSLSGLEELVLRDNKLTKVPDVSLFKK
LLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEVTKMEEIDHLHELQILELGSNRLRVME
NLQNFTKLEELWLGRNRIKAINLCGLKYIKKISLQSNRLTSMIGLEECVALEELYLSHNG
ILKMEGLSTLVNLRVLDVSSNKLTSVNDIQNLTRLEDLWLNDNQIESLESVAEAVSGSRE
KLTTVYLENNPCAKSPNYQATLRQIFPNIEQIDSSIFA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaaaccgaaccaccgccggaaactaactcggacaaagacgatcaagcgatg
gagtttgatttatcatccaccaccgctctcgatctcaccagcttccagctccacgatctc
gactcggtggaattgccgtcaagccttaccgagttggaccttactgcgaatcgcttgtcg
aaattggaccctcggattgcgaatctcattaacctcagaaagctctcttttcggcagaac
ctcattgacgatgctgctatcgagtcgatctctagctggggctcattatctggtcttgag
gagttagtactcagggataataaattgacgaaagtaccagatgtcagcttattcaagaag
ctcttggtttttgatgtttctttcaacgaaatcacttctcttcatggaatgtcgaaggtc
tccagcacactgaaggaactctatgtatccaaaaatgaagttactaagatggaggagatt
gaccacttgcatgagttgcaaattcttgaacttggttcgaacagattacgggtaatggaa
aatttgcaaaatttcacaaaattagaagagctgtggctgggaaggaatcgaattaaagct
ataaacctttgtgggctcaaatacatcaagaagattagcttgcaaagtaatcgtttaact
tctatgataggattggaggaatgtgttgctctagaagagttatatttgagccacaatggt
attttaaaaatggaaggtctatcaacattggttaacctccgagtattagacgtttcatca
aataagctaacatcagtaaatgacatacaaaacttgacaaggttggaggacttatggctc
aatgacaaccaaatagaatcacttgaaagtgtagctgaggcggtttctggttcaagagaa
aagctcaccactgtctatcttgaaaacaatccatgtgcaaaatctccaaactaccaagct
accctgagacaaattttccccaatatcgagcaaatcgattcaagcatatttgcctag

DBGET integrated database retrieval system