KEGG   Gossypium arboreum: 108463860Help
Entry
108463860         CDS       T05776                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gab  Gossypium arboreum
Pathway
gab00010  Glycolysis / Gluconeogenesis
gab00020  Citrate cycle (TCA cycle)
gab00620  Pyruvate metabolism
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
gab01200  Carbon metabolism
Module
gab_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108463860
   00020 Citrate cycle (TCA cycle)
    108463860
   00620 Pyruvate metabolism
    108463860
Enzymes [BR:gab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     108463860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 108463860
NCBI-ProteinID: XP_017619317
LinkDB All DBs
Position
13
AA seq 538 aa AA seqDB search
MQTQFGSAVFPRLLRRSLSYIPSILYSLHSLLNLFHFFRFLSNSSPQSQKHKEMASPFLS
NTIISFSSSLSSSSSLPRLAPSIPFSAIRSKSTPRRILTVRSKIREIFMPALSSTMTEGK
IVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVGAAIGILAE
TEDEIAEAKAKAASKSGASTPSAPPPAPTPAAASTPAPPKSTPAPAAPTVAEGPRKTVAT
PYAKKLAKQHKVDIESVVGTGPYGRITPEDIEAAAGLSPSKKNVGLAVVVETKPAAPAKA
PAASAAPSSLPPPVPGSTVVPFTTMQSAVSKNMVESLSVPTFRVGYPVTTDALDALYEKV
KPKGVTMTALLAKAAAMALAQHPVVNSSCKDGKSFTYNSNINIAVAVAINGGLITPVLQD
ADKLDLYLLSQKWKELVEKARAKQLQPQEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIM
AVGASKPTVVADADGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIVENAESLTL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacagttcggtagtgcagtatttcctcgtcttctccgccgctccctctcttat
attccctccattctctactctctccattcgctccttaatttatttcatttctttcgcttt
ctctccaattcctctcctcaaagccaaaaacacaaggaaatggcttctccctttctctcc
aacactatcatctccttctcttcttccctttcttcttcttcttctcttcctcgtcttgcc
ccttcaattcctttctctgcaattcgttccaagtcaaccccaagacgaatcctgaccgtc
cgttccaagatcagggagatcttcatgcctgccctcagttctaccatgaccgagggcaag
atcgtctcttgggttaaatccgaaggtgatgtactctccaaaggtgaaagcgtcgtcgtt
gtcgaatccgacaaggctgacatggatgtcgagactttctatgacggcattctcgctgct
atagttgttggggaaggcgaaactgctcctgttggtgctgccattggtattctcgctgag
actgaagatgaaattgctgaggctaaagccaaagctgcctcaaaatcaggtgcttcaacc
ccatctgctccacctcctgctccaactccagctgctgcctcaactccagctcctcccaaa
tcgacgcctgctcccgcggctccaacagttgcggaggggccgaggaagactgttgccaca
ccatatgcaaagaagttagcgaagcagcacaaggtggacattgagtctgtggttggaaca
ggtccgtatgggaggattacgccagaggacattgaggccgccgccggtctttcaccttcg
aagaaaaatgtggggcttgcagtggttgtggaaacgaagcctgcagcaccagcgaaagct
ccagctgcttctgccgccccttctagccttcctcctccagttccaggatctacagttgtg
ccgtttacgacaatgcagtccgccgtttcgaaaaatatggtggagagcctttcagtgccc
acatttcgagtggggtatcctgtgactacggacgcgcttgatgccttgtatgagaaggtg
aaaccaaagggtgtgacaatgactgctttgttagccaaagctgccgcaatggcacttgcg
cagcaccctgttgtgaattcaagctgtaaagatggcaagagttttacttacaatagtaac
atcaacattgcagtagctgttgctatcaatggtggcttgattacccctgttcttcaagat
gcagataagttggatttgtatctactgtctcaaaaatggaaagaattggtggagaaagcc
cgggcaaagcagcttcagcctcaagagtataattcggggacattcactctgtccaatctg
ggcatgtttggagtggacaggtttgatgccattcttcccccaggccagggagctatcatg
gctgttggagcatcaaagccaactgttgtagctgatgctgatggattcttcagcgtgaaa
aacaaaatgctggtgaatgttactgctgaccaccgaattatctatggtgctgatttggct
gccttccttcaaaccttctcaaagattgttgagaacgctgaaagcctcactttgtag

DBGET integrated database retrieval system