KEGG   Gossypium arboreum: 108467560Help
Entry
108467560         CDS       T05776                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
gab  Gossypium arboreum
Pathway
gab00061  Fatty acid biosynthesis
gab00780  Biotin metabolism
gab01100  Metabolic pathways
gab01212  Fatty acid metabolism
Module
gab_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    108467560
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    108467560
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    108467560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gab01004]
    108467560
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     108467560
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     108467560
Lipid biosynthesis proteins [BR:gab01004]
 Fatty acid synthase
  Component type
   108467560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 108467560
NCBI-ProteinID: XP_017623717
LinkDB All DBs
Position
3
AA seq 393 aa AA seqDB search
MTATAASGLQLASARPCIASSRRVFKAGAANLDVNSIAVSWTKLASACHLSQSLEPFRRS
FASSSVKFNKVVIKAMSESSENKPVSGLPIDLKGKRAFIAGVADDNGYGWAIAKSLAAAG
AEILVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEITKVYPLDAVFDNPDDVPEDIKT
NKRYAGSANWTVKEVAESVKQDFGSIDILVHSLANGPEVSKPLLETSRNGYLAALSASSY
SYVSLLKHFIPLMNPGGSSISLTYIASERVIPGYGGGMSSAKAALESDTRVLAFEAGRKH
KIRVNTISAGPLRSRAAKAIGFIDTMIEYSIANAPLQKELSADEVGNAAAFLASPLASAI
TGAVIYVDNGLNAMGVGVDSPIFKDLNIPGEKH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagctacagcagcttctggccttcaactagcttcagcaagaccctgcattgcatct
tctcgcagggtatttaaggctggtgctgccaatctagatgtcaattccatagctgtgtca
tggactaagctagctagtgcttgccatttatcacaatctttggagcctttccggcgcagt
tttgcatcgtcttcggtaaagtttaacaaagttgtgataaaggcaatgtctgaatctagt
gaaaataaaccggtttctgggttgccaattgacttgaaaggtaagagggcatttattgct
ggtgtagctgatgacaatggatatggctgggcaatagcgaaatctcttgctgctgcaggt
gctgaaattctagttgggacatgggtgcctgctttgaacatatttgaaaccagcttgcga
cgtggaaagttcgatgaatctcgagtattgcccgatggctctttaatggagattaccaaa
gtatatcccctagatgcagtctttgacaaccctgatgatgtacctgaagatataaaaaca
aataagcgatatgcaggatctgcaaattggactgttaaggaagttgctgaatccgttaaa
caggattttggcagcattgacattctggtgcattcgctagccaatgggccagaggtcagc
aaacctctgctggagacatcccggaacgggtatcttgcagctttatccgcttcaagttac
tcctatgtttctttactcaagcattttatcccattaatgaatccaggaggctcttcaatt
tctcttacatacattgcttctgagcgagtaattccgggatatggtggaggtatgagttct
gctaaagctgctctagaaagtgatacaagagtacttgctttcgaagcaggaagaaagcac
aaaattagggtgaacacaatatctgccggtccattaagaagtcgtgctgcaaaagcaatt
ggatttattgatacaatgatcgaatattcaatcgccaatgcacctcttcaaaaagaacta
tcagcagatgaggtggggaacgctgctgccttcttggcatcacctttggcttcggctatc
actggtgccgtcatatacgtcgataacggtctcaacgcaatgggtgttggagttgacagt
cccatatttaaagacctcaacattcctggcgaaaagcattag

DBGET integrated database retrieval system