Gossypium arboreum (tree cotton): 108469121 Help Entry 108469121         CDS       T05776                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism gab  Gossypium arboreum (tree cotton) Pathway gab03420   Nucleotide excision repair gab04120   Ubiquitin mediated proteolysis gab04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108469121    04120 Ubiquitin mediated proteolysis     108469121   09124 Replication and repair    03420 Nucleotide excision repair     108469121  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:gab04121]     108469121    03400 DNA repair and recombination proteins [BR:gab03400]     108469121 Enzymes [BR:gab01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108469121 Ubiquitin system [BR:gab04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108469121   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      108469121    Cul2 complex      108469121    Cul3 complex      108469121    Cul4 complex      108469121    Cul7 complex      108469121    Cul8 complex      108469121    Cul9 complex      108469121 DNA repair and recombination proteins [BR:gab03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108469121     TCR (transcription coupled repair) factors      Cul4-CSA complex       108469121 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  108469121 NCBI-ProteinID:  XP_017625503 UniProt:  A0A0B0PAN8 LinkDB All DBs Position 1:2135173..2137393 Genome browser AA seq 118 aa AA seqDB search MATLDSDVPMVPVGESSNSSAASSSTKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctacactagactccgatgtccccatggtacccgtcggcgagtcttccaacagctcc gccgcttcctcttccactaagaaacccaagcgtttcgagatcaaaaagtggagcgccgtt gccctttgggcttgggatattgttgtggataattgtgcaatttgcaggaatcacatcatg gatctctgtatcgaatgccaagcaaaccaagccagcgccaccagtgaggaatgcactgtt gcttggggggtctgcaaccatgcgtttcactttcactgtatcagtcgatggttgaagact cgtcaagtgtgtccattggataatagtgagtgggagttccaaaagtatggtcactaa

DBGET integrated database retrieval system