KEGG   Gossypium arboreum: 108471487Help
Entry
108471487         CDS       T05776                                 

Definition
(RefSeq) ent-kaurene oxidase, chloroplastic-like
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
gab  Gossypium arboreum
Pathway
gab00904  Diterpenoid biosynthesis
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    108471487
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:gab00199]
    108471487
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     108471487
Cytochrome P450 [BR:gab00199]
 Cytochrome P450, plant type
  CYP701 family
   108471487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 108471487
NCBI-ProteinID: XP_017628588
LinkDB All DBs
Position
4
AA seq 509 aa AA seqDB search
MAMARIFEYCQTLPFLYSLAAVFFLIFLKRFVLWGRKIGSTTLPTVPVVPGLPIVGNLLQ
LKEKKPHKTFTKWAEIYGSVYSIRTGASTVVVLNSPPTAKEAMVTRFSSISTKNLSNALK
TLTIDKSVVATSDYNEFHKMAKRFLLRNTLGSNAQRRHRHHRETMIENISSQFHVLLKED
PLRPVNFREIFESELYGLAMKQALGEDVQSIYVEELGTTLSRKEMYKILVIDMMAGIIEV
DWRDFFPDLKWIPNKVFEMSIQQKLFKMMTVMNALIKEQIKRIDSVEEVNCYLSYLLSEA
KTLTKEQITMLVWETIAESADTTLVTTEWAMYQLAKDPTRQDRLYDEMRKVCGCNKVKEE
NLSQLRYLDAVFHETLRKHSPTPLVPLRHVHEDTQIGGYYIPAGSKIAVNIYGCNMDKNH
WGNPEEWNPERFMDEKYDPLDIYKTMAFGAGKRACAGSLQAIFLICVTIGRLVQEFEWRL
NDGEEEKVDTVGLTSQKLHPLFAMLKPRE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggcacgtatctttgagtactgccaaactctcccctttctctattctctcgct
gctgtcttcttcttaattttcctcaaaagatttgtgctatggggtcgcaagataggatct
accacccttccaaccgtcccagtggtaccggggctgccaattgtaggaaatttgctgcag
ctgaaagagaagaagcctcacaagacgttcacaaaatgggcagagatatatgggtcagtt
tattcaatcaggaccggggcttctactgtggttgtgctcaattctcccccgaccgccaaa
gaggccatggtaaccaggttttcgtccatttcaacaaagaatctatcaaacgccttgaag
actctaaccattgataaaagcgtggttgcaacaagtgactacaacgagtttcacaaaatg
gccaagcgatttttactgagaaatactttgggttcaaatgctcagagacgacatcgacat
catagagaaaccatgattgaaaacatatcaagccaatttcatgttttgctcaaggaagat
cctctccgccctgttaacttcagggaaatattcgagtccgaactttatggattggcaatg
aagcaggctttgggagaagatgtgcaatcaatttatgtggaggagcttggtacaacttta
tcaagaaaagagatgtataaaatcctagtcattgacatgatggcgggtataattgaggta
gattggcgagatttcttccccgacttgaaatggattcctaacaaagtttttgaaatgagt
atccaacaaaagcttttcaagatgatgacagtcatgaatgcccttatcaaggaacagatt
aaacgaatcgattcggtggaggaagtgaattgttatctaagttacttgttatctgaagca
aagacacttacaaaggagcaaataacaatgttggtttgggagacaatcgctgaatcagca
gatactactttggtcacaacagagtgggccatgtatcagcttgctaaagatccaacccga
caggatcgtctgtatgatgaaatgagaaaggtttgtggttgtaacaaggttaaggaagaa
aatttatcccaactccgatacttggatgctgttttccatgaaaccctgaggaagcacagt
ccgactccattggttcctttaagacatgttcatgaagatacccaaataggagggtattat
ataccagcaggaagtaagattgctgttaatatctatggctgtaacatggacaagaatcac
tggggcaacccagaagagtggaatccagagaggtttatggatgagaaatacgaccctttg
gatatatacaagacgatggcctttggagctggaaaaagggcatgtgcaggctctcttcag
gcgatatttctgatttgtgtaacgattggtaggttggtgcaggaatttgagtggagattg
aatgatggagaagaagagaaagtggatacagtcgggttgacatctcagaagctgcatcca
ctgtttgcaatgctaaaacctagagaataa

DBGET integrated database retrieval system