KEGG   Gossypium arboreum: 108476364Help
Entry
108476364         CDS       T05776                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
gab  Gossypium arboreum
Pathway
gab00562  Inositol phosphate metabolism
gab01100  Metabolic pathways
gab04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108476364
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108476364
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gab01009]
    108476364
Enzymes [BR:gab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108476364
    3.1.3.48  protein-tyrosine-phosphatase
     108476364
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     108476364
Protein phosphatases and associated proteins [BR:gab01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    108476364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 108476364
NCBI-ProteinID: XP_017634050
LinkDB All DBs
Position
5
AA seq 584 aa AA seqDB search
MANISADSPTPLATDAGPDNSSTEDAPSKLSSWTRNLKIPQPFAASQEELTPTGIAGKST
FSRFTSGLGLRSPSKSTTADGNADGASTTTQPGFLGTITKGIVDSSKNAVKAVQVKARHV
VSQNKRRYQEGGFDLDLSYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIQFFETH
HKTFMQDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLILSFCQSAYSWLKEDI
ENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEKSMGYYNQKRCVDGKGLVLPSQIRYVK
YFERTLTYFNGENQPGRRCMLRGFRLLRCPYWVRPSITVSDHNGVLFSTKKHKRTKDLSP
EDYWFSAPKKGVMVFALPGEPGLTELAGDFKIHFHDRQGDFYCWLNTTMMENRKILNTSD
LDWFDKRKLPSPGFQVEVVLADYNDLVPSNPPTKTTANKPDESSGTSAAPSSNNNNKDDV
FSDVEEEESATSTNRQQKPAASSATTKSETSTNPDQVTSLVHSTGKVSLGSANSQQTHTT
GNPTKDAAAAAAGTEVSSLESEFKVMAADTSVFSFGDEEDYESE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggctaatatctctgcagactcgccgactcctttggcaacggatgcaggaccggataat
tcttctacggaagatgcaccgtcgaagctgtcatcgtggactagaaatttaaaaattcct
cagccttttgctgcctctcaagaggagttaacacctacagggattgctgggaaatcaact
ttttctcggtttactagcgggctaggattgcggtcgccttcaaaatctactactgcagat
ggtaacgctgatggagcttcgacaacaacccaacctggttttcttggaacaattacaaaa
ggcatagttgactcatctaaaaatgctgtgaaagctgtacaggtcaaggctcgacatgtt
gtttcacaaaacaaacggagataccaggagggaggatttgacttagatttgtcatacatc
actgagaatataattgctatggggttccctgctggtgacatgagctctgggttttttgga
tatgttgaggggttctatcgaaatcacatggaagaagtgattcagttttttgaaacgcat
cacaagacttttatgcaggacaagtacaaagtatataatctttgctctgagagattgtac
gatgcttcattatttgaaggaaaggtggctagtttccccttcgatgaccataattgcccc
ccaattcaattgatactatctttttgtcaaagtgcttactcatggctgaaggaggatatt
gagaatgttgtggttgtgcactgtaaagctgggatggcaaggacagggttgatgatctct
agccttcttctatacttgaagttctttcccactgctgaaaagtcaatgggctattacaac
cagaaaagatgtgtggatggaaaggggcttgttctacctagtcaaattaggtatgtcaaa
tactttgagcgcaccttaacatacttcaatggtgaaaaccagcctgggcgcaggtgcatg
cttcgaggattccggcttcttcgttgtccttattgggtcaggccctccattacagtgtct
gatcataacggtgttctcttctcgacaaagaagcataaacgtactaaggatctctctcca
gaagattattggtttagtgcaccaaagaaaggagtcatggtatttgctttgcctggggaa
cctggtctgaccgagttggccggggacttcaaaattcattttcatgatcgccaaggagat
ttttactgttggctaaacacaacaatgatggaaaacagaaaaattctgaataccagtgat
cttgattggtttgacaagaggaaattaccttcccctggtttccaggttgaggttgtgcta
gcagattataatgaccttgttccgtcgaacccaccaaccaaaactaccgcaaataagcca
gatgaaagttcaggcaccagtgcagccccatcaagcaacaataacaacaaagatgatgtg
ttctcagacgttgaggaagaagagtctgctacatcaacaaacaggcagcaaaaaccagct
gcctcctcagccaccaccaaatcggaaacgagtaccaatccagatcaagttacaagttta
gttcattctactggaaaagtttctttaggaagtgcaaactcccaacagacacacactact
ggtaacccaacaaaagatgccgctgccgctgctgctggcactgaagtttcgagcttggaa
agtgaattcaaggtaatggctgctgatacgtctgttttcagttttggagatgaagaagac
tatgaaagtgagtaa

DBGET integrated database retrieval system