KEGG   Gossypium arboreum: 108477187Help
Entry
108477187         CDS       T05776                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
gab  Gossypium arboreum
Pathway
gab00010  Glycolysis / Gluconeogenesis
gab00053  Ascorbate and aldarate metabolism
gab00071  Fatty acid degradation
gab00280  Valine, leucine and isoleucine degradation
gab00310  Lysine degradation
gab00330  Arginine and proline metabolism
gab00340  Histidine metabolism
gab00380  Tryptophan metabolism
gab00410  beta-Alanine metabolism
gab00561  Glycerolipid metabolism
gab00620  Pyruvate metabolism
gab00903  Limonene and pinene degradation
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108477187
   00053 Ascorbate and aldarate metabolism
    108477187
   00620 Pyruvate metabolism
    108477187
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108477187
   00561 Glycerolipid metabolism
    108477187
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108477187
   00310 Lysine degradation
    108477187
   00330 Arginine and proline metabolism
    108477187
   00340 Histidine metabolism
    108477187
   00380 Tryptophan metabolism
    108477187
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108477187
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    108477187
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108477187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108477187
NCBI-ProteinID: XP_017635145
UniProt: A0A0B0PRR7
LinkDB All DBs
Position
6
AA seq 531 aa AA seqDB search
MTAASRISSFLSRSLLSKGRICGVGRSVACSYTTAAALEKPFTPSIKVNYTKLLINGNFV
DSASGKTFPTYDPRTGDVIAHVAEGDAEDINRAVSAARKAFDEGPWPKMTAYERSRILFR
FADLIDQHTEELATLETWDNGKPYEQAAKIELPMISRLIRYYAGWADKIHGLTVPADSPH
LVQTIHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTVVIKTAEQTPLSALYAAKLLHE
AGLPPGVLNVVSGFGPTAGAALATHMQVDKLAFTGSTETGKIVLELAAKSNLKPVTLELG
GKSPFIVCKDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFLEKAKARALKRS
VGDPFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGDKGFYIQPTVFSNVK
EDMLIAKDEIFGPVQSILKFKDINEVIRRANTTSYGLAAGVFTQDIDTANTLTRALKVGT
VWINCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDPAWI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggcttcccgaatttcttccttcctttctcgttctctcctctctaaagggagg
atctgtggagtgggcagatcagtggcttgtagctacaccaccgctgccgctttagagaaa
ccattcactccttctatcaaggtcaactacaccaagcttttaattaatggcaactttgtt
gattctgcttcaggcaaaactttcccaacatatgatcccaggacaggagatgtgattgct
catgtagctgaaggtgatgctgaagatataaatcgagcagtttctgctgctcgaaaagcg
tttgatgaaggaccctggccaaagatgactgcttatgagagatcaaggatattattccga
tttgctgatcttattgaccaacataccgaagaacttgcaacacttgagacttgggataac
ggaaagccatacgaacaagctgctaagattgaactacccatgatctcacgtcttattcgg
tactatgctggttgggcggacaagattcatggtcttacagttccagctgatagtccacac
cttgtgcaaaccatacatgaaccaattggtgttgctggtcaaattattccgtggaatttt
cctcttctaatgtttgcttggaaggttggacctgccttggcatgtggtaatactgtcgtt
attaagacagctgagcagacaccattgtctgctctttatgctgccaagctacttcacgag
gctggacttcctccaggtgttctcaatgtggtttcagggtttggtccaactgctggcgct
gctcttgctactcatatgcaagtcgacaagcttgctttcactggatcaaccgaaacggga
aaaattgtccttgagttggctgcaaaaagcaaccttaagcccgtaacattggagctcgga
ggaaaatcgccttttattgtatgcaaggatgctgatgtcgacaaggcggttgagcttgcc
cactttgctttgttcttcaatcagggacaatgttgctgtgctggctctcgtacatacgta
catgagagtgtgtatgatgaatttttagagaaggcaaaggcacgtgcattgaaacgtagt
gttggcgatccatttgtagcaggcattgaacaaggccctcagattgattcagaacagttt
gaaaagatcatgaggtacataagatcaggtgttgaaagtggagcaactctagagaccgga
ggggagaggataggggacaagggcttctatattcaacccacagttttctccaacgtaaag
gaggacatgttgattgcgaaggatgagatatttggtccagttcagtctatcctgaaattc
aaggacatcaacgaggttattcggagggcaaatacgacgtcatatggactggcagcgggt
gtgtttacgcaggacatagacacagcaaacaccttgacacgagcactgaaagtgggaaca
gtgtggataaactgctatgacgtgtttgatgcagcgatcccatttggtgggtacaagatg
agtggacaaggcagagaaaagggtattcactgtctcagcaattacttgcaagtgaaggcc
gttgtcactcccttgaaggaccctgcatggatttaa

DBGET integrated database retrieval system