KEGG   Gossypium arboreum: 108478243Help
Entry
108478243         CDS       T05776                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial isoform X1
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
gab  Gossypium arboreum
Pathway
gab00020  Citrate cycle (TCA cycle)
gab00190  Oxidative phosphorylation
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
gab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108478243
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108478243
Enzymes [BR:gab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108478243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Acetyltransf_11 Fer2 Fer4_7
Motif
Other DBs
NCBI-GeneID: 108478243
NCBI-ProteinID: XP_017636169
LinkDB All DBs
Position
6
AA seq 312 aa AA seqDB search
MSKSLLRNGYNKVARILGKDRKQKQNFPVLEGHPAAQQHAEVTVERSGEIHDRVKKLHKE
FKIYRWNPDHPTNNKPFLQSYYVDLSNCGPMVLDALQKIKGEDDSSLSYRRSCREGICGS
CAMNVDATNTVACLKPIDVDTSKPTVLTPLPHMYVIKDLVVDLTNFYHQYRSIEPWLKTK
RAPEEGREYRQSPAERKKLDGLYECILCACCSTSCPSYWWNPEEFLGPAPLLHAFRWISD
STELGLNLVGSRDGFTQERLQALTEDHKRLYRCRTIKNCAAACPKSLNPADAIHKMKTKH
MISQVVEKVGSM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagagcttgttgcgcaacggctacaataaggtagctcggattttaggtaaagac
cgaaaacagaagcaaaattttccagtgcttgaaggccacccagctgctcagcaacatgca
gaagtaacagttgaaagaagtggggaaattcacgacagagtgaagaagcttcacaaggag
ttcaagatatataggtggaaccctgaccaccccaccaacaacaagcccttcctccagtct
tactatgtagatctttccaactgtgggcccatggttttggatgcattgcaaaagataaaa
ggtgaggatgattcaagcttgagctataggaggtcttgcagggaagggatatgtgggtct
tgtgccatgaacgttgatgcaaccaatacagtggcctgcctcaagcccattgatgtggac
acaagcaagcccactgttcttactcccttgcctcacatgtatgtgatcaaagatctggtc
gtggacctcaccaatttctaccatcagtacaggtcaattgagccatggctgaagaccaaa
agagcacccgaagaagggagagaatacaggcaatcaccagcagagaggaagaagttagat
gggttatacgagtgcatactctgtgcttgctgtagcacatcctgcccatcttactggtgg
aaccccgaggaatttcttggtccggcgcctttgcttcatgcttttcgatggatctcggac
agtactgagctgggattaaatttggttggtagccgggatggtttcactcaggaaaggctt
caggctttgacggaagatcacaaaagattgtacagatgtaggactataaaaaattgcgca
gcagcctgccccaaaagcctgaacccagctgatgcaattcataagatgaagactaagcat
atgatttctcaagtagtggagaaggttggaagcatgtag

DBGET integrated database retrieval system