KEGG   Gossypium arboreum: 108479583Help
Entry
108479583         CDS       T05776                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gab  Gossypium arboreum
Pathway
gab00250  Alanine, aspartate and glutamate metabolism
gab00410  beta-Alanine metabolism
gab00430  Taurine and hypotaurine metabolism
gab00650  Butanoate metabolism
gab01100  Metabolic pathways
gab01110  Biosynthesis of secondary metabolites
Module
gab_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108479583
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108479583
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108479583
   00430 Taurine and hypotaurine metabolism
    108479583
Enzymes [BR:gab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108479583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 108479583
NCBI-ProteinID: XP_017637766
UniProt: A0A0B0P5S3
LinkDB All DBs
Position
6
AA seq 502 aa AA seqDB search
MVLTTTNPAPKQFVESSTFASRYVRQPLPRFQMPETSMPKEAAYQVITDELMLDGNPRLN
LASFVTTWMEPECDKLMMASINKNYVDMDEYPVTTELQNRCVNMIANLFNAPIGSGEAAV
GVGTVGSSEAIMLAGLAFKRKWQQKMKSQGKPYDKPNIVTGANVQVCWEKFARYFEVELK
EVKLKEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFENVKLLNELLTKKNKETGWDT
PIHVDAASGGFIAPFVYPKIEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRSKEDLPDD
LVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKSIMENCIGNARILKEGIE
KTGRFEVVSKDVGVPLVAFALKDSTKYTVFQISDALRKFGWIVPAYTMPADAEHIAVLRV
VVREDFSCSLAERLISHIQEVLKELDSLPSRIVKDSHVVTVAKEVVGENKDAEAAKMGDR
KIQEKVTKQWRHFVKTKKTGVC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcacaaccacgaacccggcgccgaagcagtttgttgaatccagtacctttgct
tccagatatgtccgccaacctcttcccaggttccagatgccagaaacttcaatgcccaag
gaagcagcctatcaagtaataactgatgaactgatgcttgatggaaatcccaggttgaac
ttagcatcatttgtgaccacatggatggaacccgagtgcgataaactcatgatggcttcg
ataaacaagaactacgtcgacatggacgaataccctgtcaccactgagcttcagaatcga
tgtgtaaacatgatagcaaacttatttaatgcccctatcgggagcggtgaagccgcggtt
ggtgtcgggacagttggttcctctgaggcaataatgctggcaggattagcctttaaaagg
aagtggcaacaaaagatgaaatcacagggaaaaccgtatgataagcctaacatagtcacc
ggagcgaatgtgcaggtttgttgggagaagtttgcgaggtatttcgaggttgaattgaag
gaagtgaagttgaaagagggatactatgtgatggaccctgtgaaagcggttgaaatggtt
gacgagaataccatatgtgttgcagcaattctcggatccaccctaacaggggagtttgag
aatgtgaagctccttaatgaacttctcaccaagaagaataaggaaaccggttgggatacc
ccaatacatgtggatgctgctagtggagggttcattgctccctttgtttacccgaaaatc
gaatgggatttccgcctgccgttagtaaaaagcatcaatgtcagtgggcacaagtatggc
cttgtatatgctggtatcggttgggtcgtgtggagaagcaaggaggatttgccagacgat
ctcgtatttcacatcaactaccttggatccgatcagcccacattcaccttaaacttctct
aaaggctctagtcaaatcatagctcaatattatcagcttattcggctcggttttgaggga
tacaagagtatcatggaaaactgcatcgggaatgcaagaatcctgaaggaagggatagaa
aaaacgggacgattcgaagtcgtctccaaagacgtgggcgttcccctcgtggcttttgct
ctaaaagacagcactaaatacacggtgtttcaaatatccgatgccttgaggaagttcggg
tggatcgtccctgcatacacgatgcctgcagatgccgaacacatcgcagtcctgcgcgtg
gttgttagggaagacttcagttgtagcttggccgagaggcttatctcgcacattcaagag
gtgttgaaggaactcgactcgcttccgagtcgaatcgtgaaagattctcacgttgtcacc
gtcgcgaaagaagtggtaggggagaacaaagatgcggaggcagctaaaatgggtgataga
aagattcaagaaaaggttactaagcaatggaggcattttgtgaaaactaagaagacgggt
gtgtgttaa

DBGET integrated database retrieval system