KEGG   Gossypium arboreum: 108483405Help
Entry
108483405         CDS       T05776                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gab  Gossypium arboreum
Pathway
gab03030  DNA replication
gab03410  Base excision repair
gab03420  Nucleotide excision repair
gab03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108483405
   03410 Base excision repair
    108483405
   03420 Nucleotide excision repair
    108483405
   03430 Mismatch repair
    108483405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gab03032]
    108483405
   03400 DNA repair and recombination proteins [BR:gab03400]
    108483405
Enzymes [BR:gab01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108483405
    6.5.1.6  DNA ligase (ATP or NAD+)
     108483405
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108483405
DNA replication proteins [BR:gab03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108483405
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108483405
DNA repair and recombination proteins [BR:gab03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108483405
   NER (nucleotide excision repair)
    Other NER factors
     108483405
   MMR (mismatch excision repair)
    Other MMR factors
     108483405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 108483405
NCBI-ProteinID: XP_017642271
LinkDB All DBs
Position
7
AA seq 799 aa AA seqDB search
MLTFRPSHLLRYTCCITRPLTPLLPPFSSHILPSNSPFFRPKPLSLSSLNPHSNMSTRPS
AFDALMSNARRLAGKKSSSSSSPTKKRKSPDSSPTQNPNPPKTVGSTEVKHDPEVSSDGI
GKPINDSPKPDLDEAKKTPDSKKVKVGSTSERNAEMKGKIGLLKKKPADFDPNMVACWEK
GERVPFLFLSLAFDLISNETGRIVITDIVCNMFRTVIATTPDDLVATVYLAANKVAPAHE
GLELGIGDASIIKALAEACGRTESQVKSQYKDKGDLGLVAQASRSSQSMMRKPDPLTVIK
VFDTFQLIAKESGKDSQEKKKNRIKSLLVAATDCEPQYLIRLLQTKLRIGFSEQTLLAAL
GQAAVYNEQHSKPPPNVQSPLEEAAKIVKQVFSILPVYDKIVPALLTGGVWDLPKSCGFT
PGVPVGPMLAKPTKGVAEIINKFQDIDFICEYKYDGERAQIHYMENGSVEIYSRNAECNT
GKFPDVVAAISRFKKSSVKSFVLDCELVAYDRVQKKILPFQILSTRARKNVVVSEIKVDV
CIFAFDILYLDGQPLLHEQLKVRKERLYDSFEEEPGFFQFATALTSNDLEEIQIFLNSAV
SSSCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFY
GAFLLACYDENNEEFQSICKIGTGFSEAELEERSASLRSKVIPEPKSYYRCSEMMKPDVW
FETSEVWEVKAADLTISPVHRAAIGIVDPDKGISLRFPRLVRVREDKTPEQASSSEQVAE
MYNAQKHNQTNNEDDGEDD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgtttcgcccatcccatcttctccgctatacttgttgtattactcgtcctctc
acccctctccttcctcccttttcctcccatatccttccttccaactcgcctttctttcgc
cccaaacccctctctctttcttccttaaaccctcactccaacatgtccactcgcccctcc
gccttcgatgctttaatgtctaatgctcgccgtttagccggtaagaagagctcttcctct
tcttcgcccaccaagaaacgcaaatcccccgattcgtcgcccacccaaaaccctaatccc
cccaaaaccgtcggctccactgaagtcaagcacgacccagaggtttctagtgatggaatc
ggaaagcccattaacgattccccaaaacccgatttagatgaggcgaagaaaaccccggat
tcgaagaaggtgaaggtggggagcacctccgagagaaacgcggagatgaaagggaaaatt
ggtttgttgaagaagaagccggcggattttgatcccaatatggtggcgtgttgggagaaa
ggagagagggtgccgtttttgtttctgagcctggcgtttgatttgatatccaatgagacg
ggtcggattgtgataacggatattgtttgcaatatgtttaggactgttattgctaccacg
ccggatgatttggtggcgacggtttacttggcagcaaataaggttgctccggcgcacgag
gggttagagctgggaatcggtgatgcatccattatcaaggccctagctgaggcctgtggg
aggactgaatcacaggttaagagtcagtacaaggataaaggggacctgggccttgttgca
caggctagccgttcatctcaatcaatgatgcgcaagcctgatccattgactgttatcaaa
gtgtttgacacgtttcagctaattgctaaggaatctggaaaggatagtcaggagaagaaa
aagaatcgtatcaaatcacttcttgttgctgcaactgactgtgaacctcagtatttgatt
cgtctgcttcagacaaagctgcggattggattttcagagcagactctgttagctgcatta
ggacaggctgctgtatataatgaacaacattctaaaccacctccaaatgttcagtctcct
ttagaggaggctgctaagattgtcaaacaagttttttctatccttccagtctatgataaa
atagtcccagcactcttgactggtggtgtatgggatctgcctaagagttgtggctttacg
ccgggtgttcccgttggacctatgctagcaaaaccaaccaaaggtgttgctgaaatcata
aataaattccaggacattgacttcatatgtgaatataaatatgatggagagcgtgcgcag
atacactatatggagaatggttcagttgagatatacagccgaaatgctgagtgtaacact
ggaaagtttcctgatgttgttgctgcaatttctagatttaagaagtcctctgtaaaatca
tttgttttggattgtgagcttgttgcttatgatcgtgttcaaaagaaaatattacccttt
cagatccttagtacaagagcacggaaaaatgtggtagtgagtgaaataaaagttgatgtg
tgcatattcgcttttgacatcttataccttgacgggcaaccacttcttcatgagcaactg
aaagttcgtaaggagaggctttatgattcatttgaggaagaacctgggttttttcaattt
gcaacagccttaacatcaaatgatcttgaggagattcaaatattccttaattctgctgtt
tcttcaagttgtgagggtttaattatcaaaacattggatagagatgctacatatgagcca
tcgaagcggtcactcaactggctaaaattgaagaaagactacatggaaagtattggcgac
acattagatctagtacctattgctgctttccatggccgtgggaaacgaactggcttctat
ggtgcttttctcttggcatgttatgatgaaaataatgaagaattccagagtatctgtaaa
ataggtactggattttctgaagcagagcttgaggaacgttctgccagtctccgctctaaa
gtgattcctgaaccaaagtcatactatcgttgttctgagatgatgaagccggatgtatgg
tttgagacttcagaggtttgggaggtaaaagctgctgacttgaccattagccctgttcat
cgtgctgctattgggattgtggatcctgataagggcatatctctccgatttccacgttta
gttcgtgttcgagaagataagacaccagagcaagcttcatcatctgagcaggttgctgag
atgtataatgctcaaaaacacaatcaaaccaataacgaagatgatggtgaggatgattga

DBGET integrated database retrieval system